| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336500.1 | 5prime_partial | 202 | 2-610(+) |
Amino Acid sequence : | |||
| AYTYVSELWKKKQSHVMRFLLRVRCWEYRQLPAVVRVTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNAYWIN EDSTYKYYEVILIDPAHTTIRNDPRINWICNPVHKHRELRGLTSAGKKYRGLRGKGHLHHKMRPSRRATWKRNQTLSLRRYR* | |||
Physicochemical properties | |||
| Number of amino acids: | 202 | ||
| Molecular weight: | 13,752.546 | ||
| Theoretical pI: | 5.218 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10220 | ||
| Instability index: | 39.398 | ||
| aromaticity | 0.081 | ||
| GRAVY | 0.158 | ||
Secondary Structure Fraction | |||
| Helix | 0.350 | ||
| turn | 0.220 | ||
| sheet | 0.293 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336500.1 | 3prime_partial | 123 | 426-794(+) |
Amino Acid sequence : | |||
| MTRESTGFATQSTSTESSVDSHLLERNTEVSEERVTCTTRCALQGGQHGRETKHYLSAVTVNLEALFMCQSLVPVLLEFLDNLEVTFLKLSWLLVSGHQFTNPSYVCILSIYVSTVLSLN LMF | |||
Physicochemical properties | |||
| Number of amino acids: | 123 | ||
| Molecular weight: | 13,752.546 | ||
| Theoretical pI: | 5.218 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10220 | ||
| Instability index: | 39.398 | ||
| aromaticity | 0.081 | ||
| GRAVY | 0.158 | ||
Secondary Structure Fraction | |||
| Helix | 0.350 | ||
| turn | 0.220 | ||
| sheet | 0.293 | ||