Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336500.1 | 5prime_partial | 202 | 2-610(+) |
Amino Acid sequence : | |||
AYTYVSELWKKKQSHVMRFLLRVRCWEYRQLPAVVRVTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNAYWIN EDSTYKYYEVILIDPAHTTIRNDPRINWICNPVHKHRELRGLTSAGKKYRGLRGKGHLHHKMRPSRRATWKRNQTLSLRRYR* | |||
Physicochemical properties | |||
Number of amino acids: | 202 | ||
Molecular weight: | 13,752.546 | ||
Theoretical pI: | 5.218 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10220 | ||
Instability index: | 39.398 | ||
aromaticity | 0.081 | ||
GRAVY | 0.158 | ||
Secondary Structure Fraction | |||
Helix | 0.350 | ||
turn | 0.220 | ||
sheet | 0.293 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336500.1 | 3prime_partial | 123 | 426-794(+) |
Amino Acid sequence : | |||
MTRESTGFATQSTSTESSVDSHLLERNTEVSEERVTCTTRCALQGGQHGRETKHYLSAVTVNLEALFMCQSLVPVLLEFLDNLEVTFLKLSWLLVSGHQFTNPSYVCILSIYVSTVLSLN LMF | |||
Physicochemical properties | |||
Number of amino acids: | 123 | ||
Molecular weight: | 13,752.546 | ||
Theoretical pI: | 5.218 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10220 | ||
Instability index: | 39.398 | ||
aromaticity | 0.081 | ||
GRAVY | 0.158 | ||
Secondary Structure Fraction | |||
Helix | 0.350 | ||
turn | 0.220 | ||
sheet | 0.293 |