Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336503.1 | 5prime_partial | 147 | 1-444(+) |
Amino Acid sequence : | |||
SSKIHFLSIPSMASVTGSSFAISSLSSSFNPNKACLKTSSLSIKGISFPSLTVKPATRRFIITCAAKPETVDKVCEIVKKQLALPNDSAVNGESKFIALGADSLDTVEIVMGLEEAFGIT VEEENAQTIATVQDAADLIEDLVAKKC* | |||
Physicochemical properties | |||
Number of amino acids: | 147 | ||
Molecular weight: | 12,206.924 | ||
Theoretical pI: | 5.261 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
Instability index: | 51.695 | ||
aromaticity | 0.045 | ||
GRAVY | -0.138 | ||
Secondary Structure Fraction | |||
Helix | 0.273 | ||
turn | 0.191 | ||
sheet | 0.364 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336503.1 | 3prime_partial | 110 | 332-3(-) |
Amino Acid sequence : | |||
MTISTVSRESAPSAINLDSPLTAESLGRASCFFTISHTLSTVSGLAAQVMMKRRVAGFTVREGKLIPLIEREDVFKHALLGLKEEEREEMAKEDPVTEAIDGMERKWILE | |||
Physicochemical properties | |||
Number of amino acids: | 110 | ||
Molecular weight: | 12,206.924 | ||
Theoretical pI: | 5.261 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
Instability index: | 51.695 | ||
aromaticity | 0.045 | ||
GRAVY | -0.138 | ||
Secondary Structure Fraction | |||
Helix | 0.273 | ||
turn | 0.191 | ||
sheet | 0.364 |