Acc_NO	ORF type	length	start-end position (strand +/-)
>DY336506.1	5prime_partial	178	2-538(+)
Amino Acid sequence :
IAASRGLFQFLVKSIAGATAELLCRQQKGDMLELSPAVGDGFDMDQISPPERYRTGLIFATGSGISPIRSLIETGFGADRRADVRLYYGARNLNIMEYKERFEDWQSTGVNIDRVLAHPD DSWRGERGFVQDAFAKAKGVLNPQSTGAVLGGYRKMAEEVTSILVSEGVTSNAILKNF*
Physicochemical properties
Number of amino acids:		178
Molecular weight:		19,495.838
Theoretical pI:		5.930
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		18450 18450
Instability index:		39.250
aromaticity		0.090
GRAVY		-0.219
Secondary Structure Fraction
Helix		0.298
turn		0.247
sheet		0.264