Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336509.1 | 5prime_partial | 107 | 2-325(+) |
Amino Acid sequence : | |||
KADAVMLMWILHDWSDNKCIEILKKCKEAIPASTGKVMIVHAIINEDGEGDEFSGARLTLDMTMLAVMAQGKERTYKEWVHLLNEAGFSKHTVKNIKSIESVIEAYP* | |||
Physicochemical properties | |||
Number of amino acids: | 107 | ||
Molecular weight: | 12,033.883 | ||
Theoretical pI: | 5.778 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19605 | ||
Instability index: | 30.096 | ||
aromaticity | 0.065 | ||
GRAVY | -0.118 | ||
Secondary Structure Fraction | |||
Helix | 0.299 | ||
turn | 0.168 | ||
sheet | 0.318 |