| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336523.1 | internal | 241 | 1-723(+) |
Amino Acid sequence : | |||
| ISRVITVPLPTVDPISAYLESVQVEVAAVLIGKRTLLRAKSFSDTLDMRLTLDERIKDIAIKFGSQGQKSKLYRFPKEMSQLPELLFHLRRGPLLGSILGHEDDRSVLRSLFLNASFDLS LRMLAPRCLMHREGGTFEELPAYDLAMQSDAAVVLDHGTDVFIWLGAELAAQEGKSASPLAACRTLGEELTELRFPAPRILAFKEGSSQARYFVSRLIPAHKDPPYEQEARFPQLITLSA D | |||
Physicochemical properties | |||
| Number of amino acids: | 241 | ||
| Molecular weight: | 26,863.726 | ||
| Theoretical pI: | 6.267 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13075 | ||
| Instability index: | 51.802 | ||
| aromaticity | 0.075 | ||
| GRAVY | -0.054 | ||
Secondary Structure Fraction | |||
| Helix | 0.324 | ||
| turn | 0.203 | ||
| sheet | 0.336 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336523.1 | internal | 241 | 1-723(+) |
Amino Acid sequence : | |||
| ISRVITVPLPTVDPISAYLESVQVEVAAVLIGKRTLLRAKSFSDTLDMRLTLDERIKDIAIKFGSQGQKSKLYRFPKEMSQLPELLFHLRRGPLLGSILGHEDDRSVLRSLFLNASFDLS LRMLAPRCLMHREGGTFEELPAYDLAMQSDAAVVLDHGTDVFIWLGAELAAQEGKSASPLAACRTLGEELTELRFPAPRILAFKEGSSQARYFVSRLIPAHKDPPYEQEARFPQLITLSA D | |||
Physicochemical properties | |||
| Number of amino acids: | 241 | ||
| Molecular weight: | 26,863.726 | ||
| Theoretical pI: | 6.267 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13075 | ||
| Instability index: | 51.802 | ||
| aromaticity | 0.075 | ||
| GRAVY | -0.054 | ||
Secondary Structure Fraction | |||
| Helix | 0.324 | ||
| turn | 0.203 | ||
| sheet | 0.336 | ||