Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336526.1 | internal | 260 | 2-781(+) |
Amino Acid sequence : | |||
FSPPFPSIATATTTPLISPNHLPFLAAKSPFSLHSKLPNPKAASTDFEIPFFEGDDAEETAAFSPPERPEGYIPPPSFDEGPEESEEEIARAYEELYGPAYSGESYLGNDPYVMDSKVKK STGFGSKSKKEKVRDGFEERVVQVRRVTKVVKGGKQLHFMAVVVVGDKEGNVGVGVGKAKEVVAAVQKSAVNARRNIVTVPMTKYKTFPHRSEANYGAAKVMLRPASPGTGVIAGGAVRI VLELAGVENALGKQLGSNNA | |||
Physicochemical properties | |||
Number of amino acids: | 260 | ||
Molecular weight: | 12,244.859 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 115.554 | ||
aromaticity | 0.036 | ||
GRAVY | -1.146 | ||
Secondary Structure Fraction | |||
Helix | 0.116 | ||
turn | 0.446 | ||
sheet | 0.134 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336526.1 | 5prime_partial | 175 | 781-254(-) |
Amino Acid sequence : | |||
SVVTAELLPQSILHTSQLQNDPHRTSSDHTCTRRSWSQHHLGGTVVCLRSVRKGLVLGHRNGDDVPPRIHRRLLHGGDDFLRLPDPNSDIPLLISDHHNRHKMQLLPPLHHLSHPPHLHH SLLESVSHLLLLALRSESGRLLHLRIHHVGVVTEIALATVGGAVELLVSSGDLLL* | |||
Physicochemical properties | |||
Number of amino acids: | 175 | ||
Molecular weight: | 12,244.859 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 115.554 | ||
aromaticity | 0.036 | ||
GRAVY | -1.146 | ||
Secondary Structure Fraction | |||
Helix | 0.116 | ||
turn | 0.446 | ||
sheet | 0.134 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336526.1 | 5prime_partial | 112 | 3-341(+) |
Amino Acid sequence : | |||
FRHPFPQSPPPQPRLSSPPTTYHSSPRNPPSPSTPNCLTLKPPPPTSKSPSSKAMMPRKPPHSALRNAPKDTFRRLPSTKGPRSQRRRSPELTRSSTAPPTVARAISVTTPT* | |||
Physicochemical properties | |||
Number of amino acids: | 112 | ||
Molecular weight: | 12,244.859 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 115.554 | ||
aromaticity | 0.036 | ||
GRAVY | -1.146 | ||
Secondary Structure Fraction | |||
Helix | 0.116 | ||
turn | 0.446 | ||
sheet | 0.134 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336526.1 | internal | 260 | 2-781(+) |
Amino Acid sequence : | |||
FSPPFPSIATATTTPLISPNHLPFLAAKSPFSLHSKLPNPKAASTDFEIPFFEGDDAEETAAFSPPERPEGYIPPPSFDEGPEESEEEIARAYEELYGPAYSGESYLGNDPYVMDSKVKK STGFGSKSKKEKVRDGFEERVVQVRRVTKVVKGGKQLHFMAVVVVGDKEGNVGVGVGKAKEVVAAVQKSAVNARRNIVTVPMTKYKTFPHRSEANYGAAKVMLRPASPGTGVIAGGAVRI VLELAGVENALGKQLGSNNA | |||
Physicochemical properties | |||
Number of amino acids: | 260 | ||
Molecular weight: | 12,244.859 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 115.554 | ||
aromaticity | 0.036 | ||
GRAVY | -1.146 | ||
Secondary Structure Fraction | |||
Helix | 0.116 | ||
turn | 0.446 | ||
sheet | 0.134 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336526.1 | 5prime_partial | 175 | 781-254(-) |
Amino Acid sequence : | |||
SVVTAELLPQSILHTSQLQNDPHRTSSDHTCTRRSWSQHHLGGTVVCLRSVRKGLVLGHRNGDDVPPRIHRRLLHGGDDFLRLPDPNSDIPLLISDHHNRHKMQLLPPLHHLSHPPHLHH SLLESVSHLLLLALRSESGRLLHLRIHHVGVVTEIALATVGGAVELLVSSGDLLL* | |||
Physicochemical properties | |||
Number of amino acids: | 175 | ||
Molecular weight: | 12,244.859 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 115.554 | ||
aromaticity | 0.036 | ||
GRAVY | -1.146 | ||
Secondary Structure Fraction | |||
Helix | 0.116 | ||
turn | 0.446 | ||
sheet | 0.134 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336526.1 | 5prime_partial | 112 | 3-341(+) |
Amino Acid sequence : | |||
FRHPFPQSPPPQPRLSSPPTTYHSSPRNPPSPSTPNCLTLKPPPPTSKSPSSKAMMPRKPPHSALRNAPKDTFRRLPSTKGPRSQRRRSPELTRSSTAPPTVARAISVTTPT* | |||
Physicochemical properties | |||
Number of amino acids: | 112 | ||
Molecular weight: | 12,244.859 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 115.554 | ||
aromaticity | 0.036 | ||
GRAVY | -1.146 | ||
Secondary Structure Fraction | |||
Helix | 0.116 | ||
turn | 0.446 | ||
sheet | 0.134 |