Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336538.1 | internal | 265 | 1-795(+) |
Amino Acid sequence : | |||
PFVFVIMMKFKTPQKGRIRRELEKRAPKLVETGKKTLILHGTKTSQVLNDVMTEIYHLKRDNSVKYTRKNDNIRPFESGGETSLEFFSLKTDCSLFVYGSHSKKRPNNLVLGRTYDHHIY DLIEVGVEEFKSMKSFKYDKNLAPKIGSKPFFAFMGEGFESVEELKHLKEVLLDLFHGEVVTNLNLAGLDRVYVCVAVSPNRVFFTHCALRLKKSGTVVPRIELVEVGPSMDLVTRRHRL PDDSLRKEAMKTSLEKAKKKEKNVV | |||
Physicochemical properties | |||
Number of amino acids: | 265 | ||
Molecular weight: | 14,520.203 | ||
Theoretical pI: | 10.016 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
Instability index: | 31.426 | ||
aromaticity | 0.109 | ||
GRAVY | 0.385 | ||
Secondary Structure Fraction | |||
Helix | 0.422 | ||
turn | 0.219 | ||
sheet | 0.227 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336538.1 | 5prime_partial | 145 | 794-357(-) |
Amino Acid sequence : | |||
TTFFSFFFAFSREVFIASFLKLSSGRRCRRVTKSMDGPTSTNSILGTTVPDFLRRNAQCVKKTLFGDTATHTYTRSNPARFKLVTTSPWNRSSKTSFKCFNSSTLSNPSPIKAKKGLDPI LGAKFLSYLKDFMLLNSSTPTSIRS* | |||
Physicochemical properties | |||
Number of amino acids: | 145 | ||
Molecular weight: | 14,520.203 | ||
Theoretical pI: | 10.016 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
Instability index: | 31.426 | ||
aromaticity | 0.109 | ||
GRAVY | 0.385 | ||
Secondary Structure Fraction | |||
Helix | 0.422 | ||
turn | 0.219 | ||
sheet | 0.227 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336538.1 | complete | 128 | 501-115(-) |
Amino Acid sequence : | |||
MFQLFNTLKSFSHKGKKGFGPNFRSQILIIFERLHAFELLHSYLYKIVNVVIIGSSKNKIVRALLGVGTIHKKTAICLEGEKLERSLAPALKWSNVIILPGIFDGIIPLQVINFGHHIIQ YLACFRTM* | |||
Physicochemical properties | |||
Number of amino acids: | 128 | ||
Molecular weight: | 14,520.203 | ||
Theoretical pI: | 10.016 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
Instability index: | 31.426 | ||
aromaticity | 0.109 | ||
GRAVY | 0.385 | ||
Secondary Structure Fraction | |||
Helix | 0.422 | ||
turn | 0.219 | ||
sheet | 0.227 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336538.1 | internal | 265 | 1-795(+) |
Amino Acid sequence : | |||
PFVFVIMMKFKTPQKGRIRRELEKRAPKLVETGKKTLILHGTKTSQVLNDVMTEIYHLKRDNSVKYTRKNDNIRPFESGGETSLEFFSLKTDCSLFVYGSHSKKRPNNLVLGRTYDHHIY DLIEVGVEEFKSMKSFKYDKNLAPKIGSKPFFAFMGEGFESVEELKHLKEVLLDLFHGEVVTNLNLAGLDRVYVCVAVSPNRVFFTHCALRLKKSGTVVPRIELVEVGPSMDLVTRRHRL PDDSLRKEAMKTSLEKAKKKEKNVV | |||
Physicochemical properties | |||
Number of amino acids: | 265 | ||
Molecular weight: | 14,520.203 | ||
Theoretical pI: | 10.016 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
Instability index: | 31.426 | ||
aromaticity | 0.109 | ||
GRAVY | 0.385 | ||
Secondary Structure Fraction | |||
Helix | 0.422 | ||
turn | 0.219 | ||
sheet | 0.227 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336538.1 | 5prime_partial | 145 | 794-357(-) |
Amino Acid sequence : | |||
TTFFSFFFAFSREVFIASFLKLSSGRRCRRVTKSMDGPTSTNSILGTTVPDFLRRNAQCVKKTLFGDTATHTYTRSNPARFKLVTTSPWNRSSKTSFKCFNSSTLSNPSPIKAKKGLDPI LGAKFLSYLKDFMLLNSSTPTSIRS* | |||
Physicochemical properties | |||
Number of amino acids: | 145 | ||
Molecular weight: | 14,520.203 | ||
Theoretical pI: | 10.016 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
Instability index: | 31.426 | ||
aromaticity | 0.109 | ||
GRAVY | 0.385 | ||
Secondary Structure Fraction | |||
Helix | 0.422 | ||
turn | 0.219 | ||
sheet | 0.227 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336538.1 | complete | 128 | 501-115(-) |
Amino Acid sequence : | |||
MFQLFNTLKSFSHKGKKGFGPNFRSQILIIFERLHAFELLHSYLYKIVNVVIIGSSKNKIVRALLGVGTIHKKTAICLEGEKLERSLAPALKWSNVIILPGIFDGIIPLQVINFGHHIIQ YLACFRTM* | |||
Physicochemical properties | |||
Number of amino acids: | 128 | ||
Molecular weight: | 14,520.203 | ||
Theoretical pI: | 10.016 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
Instability index: | 31.426 | ||
aromaticity | 0.109 | ||
GRAVY | 0.385 | ||
Secondary Structure Fraction | |||
Helix | 0.422 | ||
turn | 0.219 | ||
sheet | 0.227 |