Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336553.1 | 5prime_partial | 176 | 2-532(+) |
Amino Acid sequence : | |||
PLSSLLLQKNNILDPKKILALRNWFAKMAIITAGISLRGPVVGRNRTFAVTKRALPKVKFSSELSFVTSQLSGIKISSTHLSSPASISVPFKTALQPVARRVCPFTGKKSNRANKVSHSN HKTKKLQFVNLQYKRIWWEEGKRFVKLRLSTKAIKTIEKNGLDAVAKKAGIDLSKK* | |||
Physicochemical properties | |||
Number of amino acids: | 176 | ||
Molecular weight: | 19,605.991 | ||
Theoretical pI: | 11.367 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 17990 | ||
Instability index: | 52.576 | ||
aromaticity | 0.068 | ||
GRAVY | -0.248 | ||
Secondary Structure Fraction | |||
Helix | 0.313 | ||
turn | 0.250 | ||
sheet | 0.216 |