| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336560.1 | internal | 159 | 2-478(+) |
Amino Acid sequence : | |||
| FCTKSGEDPYRKVACETCTKTNMVMVFGEITTNANIDYEKIVRDTCRSIGFVSDDVGLDADKCKVLVNIEQQSPDIAQGVHGHLTKRPEDIGAGDQGHMFGNSTDETPEYMPLSHGVATK LSARLTEVRKDGTCPWLRPYGKTQVTVEYYNKNGAMVPI | |||
Physicochemical properties | |||
| Number of amino acids: | 159 | ||
| Molecular weight: | 12,175.054 | ||
| Theoretical pI: | 9.425 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 23.701 | ||
| aromaticity | 0.026 | ||
| GRAVY | 0.333 | ||
Secondary Structure Fraction | |||
| Helix | 0.357 | ||
| turn | 0.235 | ||
| sheet | 0.270 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336560.1 | 3prime_partial | 115 | 346-2(-) |
Amino Acid sequence : | |||
| MTKRHVLGGFVGGVPKHVALVTGPDILRAFGQMAVNALSDIRALLLDVDKNLTLVSIETNIVGNKPNRAAGVAHDLLVVYVGVGCDLSKDHHHVGLGASLTSHLSIRVLSRLRAE | |||
Physicochemical properties | |||
| Number of amino acids: | 115 | ||
| Molecular weight: | 12,175.054 | ||
| Theoretical pI: | 9.425 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 23.701 | ||
| aromaticity | 0.026 | ||
| GRAVY | 0.333 | ||
Secondary Structure Fraction | |||
| Helix | 0.357 | ||
| turn | 0.235 | ||
| sheet | 0.270 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336560.1 | internal | 159 | 2-478(+) |
Amino Acid sequence : | |||
| FCTKSGEDPYRKVACETCTKTNMVMVFGEITTNANIDYEKIVRDTCRSIGFVSDDVGLDADKCKVLVNIEQQSPDIAQGVHGHLTKRPEDIGAGDQGHMFGNSTDETPEYMPLSHGVATK LSARLTEVRKDGTCPWLRPYGKTQVTVEYYNKNGAMVPI | |||
Physicochemical properties | |||
| Number of amino acids: | 159 | ||
| Molecular weight: | 12,175.054 | ||
| Theoretical pI: | 9.425 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 23.701 | ||
| aromaticity | 0.026 | ||
| GRAVY | 0.333 | ||
Secondary Structure Fraction | |||
| Helix | 0.357 | ||
| turn | 0.235 | ||
| sheet | 0.270 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336560.1 | 3prime_partial | 115 | 346-2(-) |
Amino Acid sequence : | |||
| MTKRHVLGGFVGGVPKHVALVTGPDILRAFGQMAVNALSDIRALLLDVDKNLTLVSIETNIVGNKPNRAAGVAHDLLVVYVGVGCDLSKDHHHVGLGASLTSHLSIRVLSRLRAE | |||
Physicochemical properties | |||
| Number of amino acids: | 115 | ||
| Molecular weight: | 12,175.054 | ||
| Theoretical pI: | 9.425 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 23.701 | ||
| aromaticity | 0.026 | ||
| GRAVY | 0.333 | ||
Secondary Structure Fraction | |||
| Helix | 0.357 | ||
| turn | 0.235 | ||
| sheet | 0.270 | ||