| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336583.1 | internal | 213 | 641-3(-) |
Amino Acid sequence : | |||
| PLPIQCLPFHKQRILLTLKPSIEHNPIHVVVHHQLQAPPQHYPVRRRLRILLHVIHDGGGLRLPPVAVLLPPLVGEKRNRHDPPHLPPVLAVNGEPHVLPLPGENLPPNIGSSRSELNPL RVEDLLRVVRRRNDDEVALPHAEEENIAELLRVVGEIPVVEIVADSKPVSEDWHRNRPRRQLELPAAELRDHGGDDDGEEAAEKRLLEEEKIH | |||
Physicochemical properties | |||
| Number of amino acids: | 213 | ||
| Molecular weight: | 14,235.463 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22000 22125 | ||
| Instability index: | 109.334 | ||
| aromaticity | 0.090 | ||
| GRAVY | -0.805 | ||
Secondary Structure Fraction | |||
| Helix | 0.143 | ||
| turn | 0.444 | ||
| sheet | 0.120 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336583.1 | complete | 140 | 3-425(+) |
Amino Acid sequence : | |||
| MDLLLLEKTLLGGFFAIVVAAVVSKLRGRKFKLPPGPIPVPIFGNWLRVGDDLYHRNLTDYAKKFGDIFLLRMGQRNLVVVSSPDHAKEVLHTQGVEFGSRTPNVGGEIFTGKGQDMGFT VYGEHWRKMRRIMTVPFFTN* | |||
Physicochemical properties | |||
| Number of amino acids: | 140 | ||
| Molecular weight: | 14,235.463 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22000 22125 | ||
| Instability index: | 109.334 | ||
| aromaticity | 0.090 | ||
| GRAVY | -0.805 | ||
Secondary Structure Fraction | |||
| Helix | 0.143 | ||
| turn | 0.444 | ||
| sheet | 0.120 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336583.1 | 5prime_partial | 133 | 1-402(+) |
Amino Acid sequence : | |||
| KWIFSSSRRRFSAASSPSSSPPWSRSSAAGSSSCRRGRFRCQSSETGFESATISTTGISPTTRRSSAIFSSSAWGSATSSSFRRRTTRRRSSTRRGLSSDRELPMLGGRFSPGRGRTWGS PFTASTGGRCGGS* | |||
Physicochemical properties | |||
| Number of amino acids: | 133 | ||
| Molecular weight: | 14,235.463 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22000 22125 | ||
| Instability index: | 109.334 | ||
| aromaticity | 0.090 | ||
| GRAVY | -0.805 | ||
Secondary Structure Fraction | |||
| Helix | 0.143 | ||
| turn | 0.444 | ||
| sheet | 0.120 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336583.1 | internal | 213 | 641-3(-) |
Amino Acid sequence : | |||
| PLPIQCLPFHKQRILLTLKPSIEHNPIHVVVHHQLQAPPQHYPVRRRLRILLHVIHDGGGLRLPPVAVLLPPLVGEKRNRHDPPHLPPVLAVNGEPHVLPLPGENLPPNIGSSRSELNPL RVEDLLRVVRRRNDDEVALPHAEEENIAELLRVVGEIPVVEIVADSKPVSEDWHRNRPRRQLELPAAELRDHGGDDDGEEAAEKRLLEEEKIH | |||
Physicochemical properties | |||
| Number of amino acids: | 213 | ||
| Molecular weight: | 14,235.463 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22000 22125 | ||
| Instability index: | 109.334 | ||
| aromaticity | 0.090 | ||
| GRAVY | -0.805 | ||
Secondary Structure Fraction | |||
| Helix | 0.143 | ||
| turn | 0.444 | ||
| sheet | 0.120 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336583.1 | complete | 140 | 3-425(+) |
Amino Acid sequence : | |||
| MDLLLLEKTLLGGFFAIVVAAVVSKLRGRKFKLPPGPIPVPIFGNWLRVGDDLYHRNLTDYAKKFGDIFLLRMGQRNLVVVSSPDHAKEVLHTQGVEFGSRTPNVGGEIFTGKGQDMGFT VYGEHWRKMRRIMTVPFFTN* | |||
Physicochemical properties | |||
| Number of amino acids: | 140 | ||
| Molecular weight: | 14,235.463 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22000 22125 | ||
| Instability index: | 109.334 | ||
| aromaticity | 0.090 | ||
| GRAVY | -0.805 | ||
Secondary Structure Fraction | |||
| Helix | 0.143 | ||
| turn | 0.444 | ||
| sheet | 0.120 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336583.1 | 5prime_partial | 133 | 1-402(+) |
Amino Acid sequence : | |||
| KWIFSSSRRRFSAASSPSSSPPWSRSSAAGSSSCRRGRFRCQSSETGFESATISTTGISPTTRRSSAIFSSSAWGSATSSSFRRRTTRRRSSTRRGLSSDRELPMLGGRFSPGRGRTWGS PFTASTGGRCGGS* | |||
Physicochemical properties | |||
| Number of amino acids: | 133 | ||
| Molecular weight: | 14,235.463 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22000 22125 | ||
| Instability index: | 109.334 | ||
| aromaticity | 0.090 | ||
| GRAVY | -0.805 | ||
Secondary Structure Fraction | |||
| Helix | 0.143 | ||
| turn | 0.444 | ||
| sheet | 0.120 | ||