| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336590.1 | internal | 210 | 3-632(+) |
Amino Acid sequence : | |||
| FHKDEEKYAKIEYMRCTPKNGFFPDLATVRKTDIIFFCSPNNPTGYAASREQLTKLVQFAKENGSIIFYDSAYAMYVSDDIPRSIFEIPGAKEVALEVSSFSKYAGFTGVRLGWTAIPKE LHYSDGFPVAKDFNRIVCTCFNGASNIAQAGGLACVSPEGIKVMHDVVGFYEENTNIIVDTFNSLGFKVYGGKNAPYVWVYFPGRISWDV | |||
Physicochemical properties | |||
| Number of amino acids: | 210 | ||
| Molecular weight: | 23,464.393 | ||
| Theoretical pI: | 5.959 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 34380 34630 | ||
| Instability index: | 44.286 | ||
| aromaticity | 0.152 | ||
| GRAVY | -0.097 | ||
Secondary Structure Fraction | |||
| Helix | 0.343 | ||
| turn | 0.252 | ||
| sheet | 0.190 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336590.1 | internal | 210 | 3-632(+) |
Amino Acid sequence : | |||
| FHKDEEKYAKIEYMRCTPKNGFFPDLATVRKTDIIFFCSPNNPTGYAASREQLTKLVQFAKENGSIIFYDSAYAMYVSDDIPRSIFEIPGAKEVALEVSSFSKYAGFTGVRLGWTAIPKE LHYSDGFPVAKDFNRIVCTCFNGASNIAQAGGLACVSPEGIKVMHDVVGFYEENTNIIVDTFNSLGFKVYGGKNAPYVWVYFPGRISWDV | |||
Physicochemical properties | |||
| Number of amino acids: | 210 | ||
| Molecular weight: | 23,464.393 | ||
| Theoretical pI: | 5.959 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 34380 34630 | ||
| Instability index: | 44.286 | ||
| aromaticity | 0.152 | ||
| GRAVY | -0.097 | ||
Secondary Structure Fraction | |||
| Helix | 0.343 | ||
| turn | 0.252 | ||
| sheet | 0.190 | ||