Acc_NO	ORF type	length	start-end position (strand +/-)
>DY336600.1	5prime_partial	167	2-505(+)
Amino Acid sequence :
GSPPTTRVFGENAAVLAGDAMLTFAFEHVAAATRGVAPERVVRAVRELANLIGSEGLSRGQVVDVSSEGMAAVGLNHLELIHRLKTAVLVQASVVLGAVVGGASEEEIEKLRRFASCIRL LFQVEDDILDVTKSSAELGKTAGKDLAADKATYPKLIGLEKSTELAD*
Physicochemical properties
Number of amino acids:		167
Molecular weight:		17,508.822
Theoretical pI:		5.285
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		1490 1490
Instability index:		33.885
aromaticity		0.036
GRAVY		0.181
Secondary Structure Fraction
Helix		0.305
turn		0.198
sheet		0.365