Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336600.1 | 5prime_partial | 167 | 2-505(+) |
Amino Acid sequence : | |||
GSPPTTRVFGENAAVLAGDAMLTFAFEHVAAATRGVAPERVVRAVRELANLIGSEGLSRGQVVDVSSEGMAAVGLNHLELIHRLKTAVLVQASVVLGAVVGGASEEEIEKLRRFASCIRL LFQVEDDILDVTKSSAELGKTAGKDLAADKATYPKLIGLEKSTELAD* | |||
Physicochemical properties | |||
Number of amino acids: | 167 | ||
Molecular weight: | 17,508.822 | ||
Theoretical pI: | 5.285 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 33.885 | ||
aromaticity | 0.036 | ||
GRAVY | 0.181 | ||
Secondary Structure Fraction | |||
Helix | 0.305 | ||
turn | 0.198 | ||
sheet | 0.365 |