| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336604.1 | internal | 263 | 2-790(+) |
Amino Acid sequence : | |||
| GFPKIPSPSLSLSQQTANYLDPLTGIPNSHMAPREENVYMAKLAEQAERYEEMVEYMEKVSAALEDKEELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEESRGNEDHVSTIKEYRS KIETELSKICDGILKLLDDRLIPSAGAGDSKVFYLKMKGDYHRYLAEFKTAAERKEAAESTLNAYKAAQDIAVSELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELD TLGEESYKDSTLIMQLLRDNLTL | |||
Physicochemical properties | |||
| Number of amino acids: | 263 | ||
| Molecular weight: | 11,672.037 | ||
| Theoretical pI: | 11.369 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3230 | ||
| Instability index: | 27.268 | ||
| aromaticity | 0.047 | ||
| GRAVY | -0.781 | ||
Secondary Structure Fraction | |||
| Helix | 0.196 | ||
| turn | 0.280 | ||
| sheet | 0.234 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336604.1 | complete | 139 | 487-68(-) |
Amino Acid sequence : | |||
| MVITFHLKIENLGIAGAGGRNEAIVEQLENSITDLGELGLDLRSVLLDRRNVVLVTPGFLLLLDRGDNPPGRPPGTDNILVGDREQVALLDGEFLFVLECGGYFLHVLHHFLVALGLLGQ LGHVDVLLSRRHVRIWYPC* | |||
Physicochemical properties | |||
| Number of amino acids: | 139 | ||
| Molecular weight: | 11,672.037 | ||
| Theoretical pI: | 11.369 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3230 | ||
| Instability index: | 27.268 | ||
| aromaticity | 0.047 | ||
| GRAVY | -0.781 | ||
Secondary Structure Fraction | |||
| Helix | 0.196 | ||
| turn | 0.280 | ||
| sheet | 0.234 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336604.1 | 5prime_partial | 107 | 1-324(+) |
Amino Acid sequence : | |||
| RFPKNSLTLSFSLPTNCKLSRSVNRDTKFSHGAARGERLHGQAGRAGRALRGNGGVHGESIRRTRGQRGTHRRGAQPALCRLQECYRCQAGVLADYLLDRAEGGIQG* | |||
Physicochemical properties | |||
| Number of amino acids: | 107 | ||
| Molecular weight: | 11,672.037 | ||
| Theoretical pI: | 11.369 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3230 | ||
| Instability index: | 27.268 | ||
| aromaticity | 0.047 | ||
| GRAVY | -0.781 | ||
Secondary Structure Fraction | |||
| Helix | 0.196 | ||
| turn | 0.280 | ||
| sheet | 0.234 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336604.1 | internal | 263 | 2-790(+) |
Amino Acid sequence : | |||
| GFPKIPSPSLSLSQQTANYLDPLTGIPNSHMAPREENVYMAKLAEQAERYEEMVEYMEKVSAALEDKEELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEESRGNEDHVSTIKEYRS KIETELSKICDGILKLLDDRLIPSAGAGDSKVFYLKMKGDYHRYLAEFKTAAERKEAAESTLNAYKAAQDIAVSELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELD TLGEESYKDSTLIMQLLRDNLTL | |||
Physicochemical properties | |||
| Number of amino acids: | 263 | ||
| Molecular weight: | 11,672.037 | ||
| Theoretical pI: | 11.369 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3230 | ||
| Instability index: | 27.268 | ||
| aromaticity | 0.047 | ||
| GRAVY | -0.781 | ||
Secondary Structure Fraction | |||
| Helix | 0.196 | ||
| turn | 0.280 | ||
| sheet | 0.234 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336604.1 | complete | 139 | 487-68(-) |
Amino Acid sequence : | |||
| MVITFHLKIENLGIAGAGGRNEAIVEQLENSITDLGELGLDLRSVLLDRRNVVLVTPGFLLLLDRGDNPPGRPPGTDNILVGDREQVALLDGEFLFVLECGGYFLHVLHHFLVALGLLGQ LGHVDVLLSRRHVRIWYPC* | |||
Physicochemical properties | |||
| Number of amino acids: | 139 | ||
| Molecular weight: | 11,672.037 | ||
| Theoretical pI: | 11.369 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3230 | ||
| Instability index: | 27.268 | ||
| aromaticity | 0.047 | ||
| GRAVY | -0.781 | ||
Secondary Structure Fraction | |||
| Helix | 0.196 | ||
| turn | 0.280 | ||
| sheet | 0.234 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336604.1 | 5prime_partial | 107 | 1-324(+) |
Amino Acid sequence : | |||
| RFPKNSLTLSFSLPTNCKLSRSVNRDTKFSHGAARGERLHGQAGRAGRALRGNGGVHGESIRRTRGQRGTHRRGAQPALCRLQECYRCQAGVLADYLLDRAEGGIQG* | |||
Physicochemical properties | |||
| Number of amino acids: | 107 | ||
| Molecular weight: | 11,672.037 | ||
| Theoretical pI: | 11.369 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3230 | ||
| Instability index: | 27.268 | ||
| aromaticity | 0.047 | ||
| GRAVY | -0.781 | ||
Secondary Structure Fraction | |||
| Helix | 0.196 | ||
| turn | 0.280 | ||
| sheet | 0.234 | ||