| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336610.1 | internal | 264 | 1-792(+) |
Amino Acid sequence : | |||
| APRLSSPYKLHPMALQNMDISLSTEQLLQAQAHVWNHMYAFANSMSLKCAIQLGIPDILHKHDHPMTLSQLLQAIPINKEKSQSFQRLMRALVNSNFFTEENSNNQEVCYWLTPASRLLL KGAPLTVAPLVQVVLDPTFTNPWHYMSEWFKHENHATQFEAANGCTFWEKLANKPSMGRFFDEAMSCDSRLVAHVLTKDYKHVIDGIRTLVDVGGGNGTMVKAIVEAVPTMKCTVLDLPH VVAGLESTDKLSYIGGDMFQSIPS | |||
Physicochemical properties | |||
| Number of amino acids: | 264 | ||
| Molecular weight: | 29,566.745 | ||
| Theoretical pI: | 6.471 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 36440 36690 | ||
| Instability index: | 44.198 | ||
| aromaticity | 0.083 | ||
| GRAVY | -0.119 | ||
Secondary Structure Fraction | |||
| Helix | 0.303 | ||
| turn | 0.231 | ||
| sheet | 0.280 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336610.1 | internal | 264 | 1-792(+) |
Amino Acid sequence : | |||
| APRLSSPYKLHPMALQNMDISLSTEQLLQAQAHVWNHMYAFANSMSLKCAIQLGIPDILHKHDHPMTLSQLLQAIPINKEKSQSFQRLMRALVNSNFFTEENSNNQEVCYWLTPASRLLL KGAPLTVAPLVQVVLDPTFTNPWHYMSEWFKHENHATQFEAANGCTFWEKLANKPSMGRFFDEAMSCDSRLVAHVLTKDYKHVIDGIRTLVDVGGGNGTMVKAIVEAVPTMKCTVLDLPH VVAGLESTDKLSYIGGDMFQSIPS | |||
Physicochemical properties | |||
| Number of amino acids: | 264 | ||
| Molecular weight: | 29,566.745 | ||
| Theoretical pI: | 6.471 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 36440 36690 | ||
| Instability index: | 44.198 | ||
| aromaticity | 0.083 | ||
| GRAVY | -0.119 | ||
Secondary Structure Fraction | |||
| Helix | 0.303 | ||
| turn | 0.231 | ||
| sheet | 0.280 | ||