| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336611.1 | internal | 248 | 3-746(+) |
Amino Acid sequence : | |||
| LKLPSEEYWSSALPFTVMPKSVKDLLTDDKSGVNVGVNIGGHGHDKDKDHDHDKDHGESHKNHKPVNVHVAPFNYHYAATETQLHDSPNVALFFLEKDLYAGNKMTLQFSKDTNQQKFLP RQVADSIPFSSDKLPEIYTKFSVEPDSDEAEAMKKTIEECEEKGIKGEEKVCATSLESMVDFATSKIGNNVEAVSTEAHSSERKVYRIEGVSRKPSNKPVVVCHQQEYEYAVFYCHKTET TVAYDVSL | |||
Physicochemical properties | |||
| Number of amino acids: | 248 | ||
| Molecular weight: | 12,338.372 | ||
| Theoretical pI: | 10.234 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 50.320 | ||
| aromaticity | 0.104 | ||
| GRAVY | 0.258 | ||
Secondary Structure Fraction | |||
| Helix | 0.425 | ||
| turn | 0.160 | ||
| sheet | 0.255 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336611.1 | 5prime_partial | 106 | 746-426(-) |
Amino Acid sequence : | |||
| ERNIVGHRRLSLVAVKHSILILLLVAHDHRLVTRLPRHSLDTVHFPLRTMRFCRHCFDVVPYFRRGEIDHGLQRSSTDLLLPFYALFLAFFDGFLHGLGLVGIRLD* | |||
Physicochemical properties | |||
| Number of amino acids: | 106 | ||
| Molecular weight: | 12,338.372 | ||
| Theoretical pI: | 10.234 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 50.320 | ||
| aromaticity | 0.104 | ||
| GRAVY | 0.258 | ||
Secondary Structure Fraction | |||
| Helix | 0.425 | ||
| turn | 0.160 | ||
| sheet | 0.255 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336611.1 | internal | 248 | 3-746(+) |
Amino Acid sequence : | |||
| LKLPSEEYWSSALPFTVMPKSVKDLLTDDKSGVNVGVNIGGHGHDKDKDHDHDKDHGESHKNHKPVNVHVAPFNYHYAATETQLHDSPNVALFFLEKDLYAGNKMTLQFSKDTNQQKFLP RQVADSIPFSSDKLPEIYTKFSVEPDSDEAEAMKKTIEECEEKGIKGEEKVCATSLESMVDFATSKIGNNVEAVSTEAHSSERKVYRIEGVSRKPSNKPVVVCHQQEYEYAVFYCHKTET TVAYDVSL | |||
Physicochemical properties | |||
| Number of amino acids: | 248 | ||
| Molecular weight: | 12,338.372 | ||
| Theoretical pI: | 10.234 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 50.320 | ||
| aromaticity | 0.104 | ||
| GRAVY | 0.258 | ||
Secondary Structure Fraction | |||
| Helix | 0.425 | ||
| turn | 0.160 | ||
| sheet | 0.255 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336611.1 | 5prime_partial | 106 | 746-426(-) |
Amino Acid sequence : | |||
| ERNIVGHRRLSLVAVKHSILILLLVAHDHRLVTRLPRHSLDTVHFPLRTMRFCRHCFDVVPYFRRGEIDHGLQRSSTDLLLPFYALFLAFFDGFLHGLGLVGIRLD* | |||
Physicochemical properties | |||
| Number of amino acids: | 106 | ||
| Molecular weight: | 12,338.372 | ||
| Theoretical pI: | 10.234 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 50.320 | ||
| aromaticity | 0.104 | ||
| GRAVY | 0.258 | ||
Secondary Structure Fraction | |||
| Helix | 0.425 | ||
| turn | 0.160 | ||
| sheet | 0.255 | ||