Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336614.1 | 3prime_partial | 232 | 51-746(+) |
Amino Acid sequence : | |||
MAFDKIKVASPIVEMDGDEMTRVIWQMIKDKLIFPFLELDIKYFDLGITHRDATDDKVTIESAEATLKYNVAIKCATITPDEARVKEFGLKQMWKSPNGTIRNILNGTVFREPILCKNVP RLIPGWTKPICIGRHAFGDQYRATDAVIKGPGKLKLVFVPESREKTEMEVYDFTGAGGVALSMYNTDESIRSFAESSMNTAYLKKWPLYLITKNTILEKYDGRFKDIFQEVY | |||
Physicochemical properties | |||
Number of amino acids: | 232 | ||
Molecular weight: | 16,094.109 | ||
Theoretical pI: | 10.113 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6210 | ||
Instability index: | 46.568 | ||
aromaticity | 0.088 | ||
GRAVY | 0.691 | ||
Secondary Structure Fraction | |||
Helix | 0.385 | ||
turn | 0.277 | ||
sheet | 0.236 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336614.1 | complete | 149 | 455-6(-) |
Amino Acid sequence : | |||
MSSNAYRLCPTWDKSRNIFAENWFSKDSAIQNVPNCTIWTLPHLLQAKLLNTSLIWSNCRTLNCHIILKSSFRTLNGHFIIRGITVRNAKVKVLNIQLQEREDQLVLDHLPDDPRHLISI HLNDGAGHLDLVECHHSSLCLLFIYFLLQ* | |||
Physicochemical properties | |||
Number of amino acids: | 149 | ||
Molecular weight: | 16,094.109 | ||
Theoretical pI: | 10.113 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6210 | ||
Instability index: | 46.568 | ||
aromaticity | 0.088 | ||
GRAVY | 0.691 | ||
Secondary Structure Fraction | |||
Helix | 0.385 | ||
turn | 0.277 | ||
sheet | 0.236 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336614.1 | 3prime_partial | 148 | 445-2(-) |
Amino Acid sequence : | |||
MHIGFVQPGISRGTFLQRIGSLKTVPFKMFLIVPFGLFHICFKPNSLTRASSGVIVAHLIATLYLRVASALSMVTLSSVASRCVMPRSKYLISNSKKGKINLSLIICQMTLVISSPSIST MGLATLILSNAITLPYAFCLSTFSYNED | |||
Physicochemical properties | |||
Number of amino acids: | 148 | ||
Molecular weight: | 16,094.109 | ||
Theoretical pI: | 10.113 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6210 | ||
Instability index: | 46.568 | ||
aromaticity | 0.088 | ||
GRAVY | 0.691 | ||
Secondary Structure Fraction | |||
Helix | 0.385 | ||
turn | 0.277 | ||
sheet | 0.236 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336614.1 | 3prime_partial | 232 | 51-746(+) |
Amino Acid sequence : | |||
MAFDKIKVASPIVEMDGDEMTRVIWQMIKDKLIFPFLELDIKYFDLGITHRDATDDKVTIESAEATLKYNVAIKCATITPDEARVKEFGLKQMWKSPNGTIRNILNGTVFREPILCKNVP RLIPGWTKPICIGRHAFGDQYRATDAVIKGPGKLKLVFVPESREKTEMEVYDFTGAGGVALSMYNTDESIRSFAESSMNTAYLKKWPLYLITKNTILEKYDGRFKDIFQEVY | |||
Physicochemical properties | |||
Number of amino acids: | 232 | ||
Molecular weight: | 16,094.109 | ||
Theoretical pI: | 10.113 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6210 | ||
Instability index: | 46.568 | ||
aromaticity | 0.088 | ||
GRAVY | 0.691 | ||
Secondary Structure Fraction | |||
Helix | 0.385 | ||
turn | 0.277 | ||
sheet | 0.236 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336614.1 | complete | 149 | 455-6(-) |
Amino Acid sequence : | |||
MSSNAYRLCPTWDKSRNIFAENWFSKDSAIQNVPNCTIWTLPHLLQAKLLNTSLIWSNCRTLNCHIILKSSFRTLNGHFIIRGITVRNAKVKVLNIQLQEREDQLVLDHLPDDPRHLISI HLNDGAGHLDLVECHHSSLCLLFIYFLLQ* | |||
Physicochemical properties | |||
Number of amino acids: | 149 | ||
Molecular weight: | 16,094.109 | ||
Theoretical pI: | 10.113 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6210 | ||
Instability index: | 46.568 | ||
aromaticity | 0.088 | ||
GRAVY | 0.691 | ||
Secondary Structure Fraction | |||
Helix | 0.385 | ||
turn | 0.277 | ||
sheet | 0.236 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336614.1 | 3prime_partial | 148 | 445-2(-) |
Amino Acid sequence : | |||
MHIGFVQPGISRGTFLQRIGSLKTVPFKMFLIVPFGLFHICFKPNSLTRASSGVIVAHLIATLYLRVASALSMVTLSSVASRCVMPRSKYLISNSKKGKINLSLIICQMTLVISSPSIST MGLATLILSNAITLPYAFCLSTFSYNED | |||
Physicochemical properties | |||
Number of amino acids: | 148 | ||
Molecular weight: | 16,094.109 | ||
Theoretical pI: | 10.113 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6210 | ||
Instability index: | 46.568 | ||
aromaticity | 0.088 | ||
GRAVY | 0.691 | ||
Secondary Structure Fraction | |||
Helix | 0.385 | ||
turn | 0.277 | ||
sheet | 0.236 |