Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336615.1 | internal | 242 | 1-726(+) |
Amino Acid sequence : | |||
PFTSTAAKSPPPSPPKMDLLLLEKTLLGVFFAIVVAAVVSKLRGRKFKLPPGPIPVPIFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRMGQRNLVVVSSPDHAKEVLHTQGVEFGSRTRN VVFDIFTGKGQDMVFTVYGEHWRKMRRIMTVPFFTNKVVQQYRFGWEAEAAAVVDDVKKNPESATNGIVLRRRLQLMMYNNMYRIMFDRRFESEEDPLFVKLKALNGERSRLAQSFQYNY GD | |||
Physicochemical properties | |||
Number of amino acids: | 242 | ||
Molecular weight: | 12,470.767 | ||
Theoretical pI: | 11.856 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 114.768 | ||
aromaticity | 0.027 | ||
GRAVY | -1.282 | ||
Secondary Structure Fraction | |||
Helix | 0.144 | ||
turn | 0.288 | ||
sheet | 0.252 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336615.1 | 5prime_partial | 229 | 726-37(-) |
Amino Acid sequence : | |||
IAIVVLEALRQSTPLPIQRLQFHKQRIFLTLKPSIEHNPIHVVVHHQLQAPPQHDPVRRRLRILLHVIHDGGGLRLPPEAVLLHHLVGEKRNRHDPPHLPPVLAVNGEHHVLPLPGENIE HNIASSRAELNPLRVEDLLRVVRRRNDDEVALPHAEEENIAELLRVVGEIPVVEIVADLKPVSEDRHRNRPRRQLELPAAELRHHGGDDDGEEDAEKRLLEEEKIHFRW* | |||
Physicochemical properties | |||
Number of amino acids: | 229 | ||
Molecular weight: | 12,470.767 | ||
Theoretical pI: | 11.856 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 114.768 | ||
aromaticity | 0.027 | ||
GRAVY | -1.282 | ||
Secondary Structure Fraction | |||
Helix | 0.144 | ||
turn | 0.288 | ||
sheet | 0.252 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336615.1 | 5prime_partial | 148 | 2-448(+) |
Amino Acid sequence : | |||
HSPPPPRNLHRHHHRKWIFSSSRRRFSASSSPSSSPPWCRSSAAGSSSCRRGRFRCRSSETGFKSATISTTGISPTTRRSSAIFSSSAWGSATSSSFRRRTTRRRSSTRRGLSSARELAM LCSIFSPGRGRTWCSPFTASTGGRCGGS* | |||
Physicochemical properties | |||
Number of amino acids: | 148 | ||
Molecular weight: | 12,470.767 | ||
Theoretical pI: | 11.856 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 114.768 | ||
aromaticity | 0.027 | ||
GRAVY | -1.282 | ||
Secondary Structure Fraction | |||
Helix | 0.144 | ||
turn | 0.288 | ||
sheet | 0.252 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336615.1 | 5prime_partial | 111 | 3-338(+) |
Amino Acid sequence : | |||
IHLHRREISTAITTENGSSPPREDASRRLLRHRRRRRGVEAPRQEVQAAAGADSGADLRKLASSRRRSQPPESHRLREEVRRYFPPPHGAAQPRRRFVAGPREGGPPHAGG* | |||
Physicochemical properties | |||
Number of amino acids: | 111 | ||
Molecular weight: | 12,470.767 | ||
Theoretical pI: | 11.856 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 114.768 | ||
aromaticity | 0.027 | ||
GRAVY | -1.282 | ||
Secondary Structure Fraction | |||
Helix | 0.144 | ||
turn | 0.288 | ||
sheet | 0.252 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336615.1 | internal | 242 | 1-726(+) |
Amino Acid sequence : | |||
PFTSTAAKSPPPSPPKMDLLLLEKTLLGVFFAIVVAAVVSKLRGRKFKLPPGPIPVPIFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRMGQRNLVVVSSPDHAKEVLHTQGVEFGSRTRN VVFDIFTGKGQDMVFTVYGEHWRKMRRIMTVPFFTNKVVQQYRFGWEAEAAAVVDDVKKNPESATNGIVLRRRLQLMMYNNMYRIMFDRRFESEEDPLFVKLKALNGERSRLAQSFQYNY GD | |||
Physicochemical properties | |||
Number of amino acids: | 242 | ||
Molecular weight: | 12,470.767 | ||
Theoretical pI: | 11.856 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 114.768 | ||
aromaticity | 0.027 | ||
GRAVY | -1.282 | ||
Secondary Structure Fraction | |||
Helix | 0.144 | ||
turn | 0.288 | ||
sheet | 0.252 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336615.1 | 5prime_partial | 229 | 726-37(-) |
Amino Acid sequence : | |||
IAIVVLEALRQSTPLPIQRLQFHKQRIFLTLKPSIEHNPIHVVVHHQLQAPPQHDPVRRRLRILLHVIHDGGGLRLPPEAVLLHHLVGEKRNRHDPPHLPPVLAVNGEHHVLPLPGENIE HNIASSRAELNPLRVEDLLRVVRRRNDDEVALPHAEEENIAELLRVVGEIPVVEIVADLKPVSEDRHRNRPRRQLELPAAELRHHGGDDDGEEDAEKRLLEEEKIHFRW* | |||
Physicochemical properties | |||
Number of amino acids: | 229 | ||
Molecular weight: | 12,470.767 | ||
Theoretical pI: | 11.856 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 114.768 | ||
aromaticity | 0.027 | ||
GRAVY | -1.282 | ||
Secondary Structure Fraction | |||
Helix | 0.144 | ||
turn | 0.288 | ||
sheet | 0.252 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336615.1 | 5prime_partial | 148 | 2-448(+) |
Amino Acid sequence : | |||
HSPPPPRNLHRHHHRKWIFSSSRRRFSASSSPSSSPPWCRSSAAGSSSCRRGRFRCRSSETGFKSATISTTGISPTTRRSSAIFSSSAWGSATSSSFRRRTTRRRSSTRRGLSSARELAM LCSIFSPGRGRTWCSPFTASTGGRCGGS* | |||
Physicochemical properties | |||
Number of amino acids: | 148 | ||
Molecular weight: | 12,470.767 | ||
Theoretical pI: | 11.856 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 114.768 | ||
aromaticity | 0.027 | ||
GRAVY | -1.282 | ||
Secondary Structure Fraction | |||
Helix | 0.144 | ||
turn | 0.288 | ||
sheet | 0.252 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336615.1 | 5prime_partial | 111 | 3-338(+) |
Amino Acid sequence : | |||
IHLHRREISTAITTENGSSPPREDASRRLLRHRRRRRGVEAPRQEVQAAAGADSGADLRKLASSRRRSQPPESHRLREEVRRYFPPPHGAAQPRRRFVAGPREGGPPHAGG* | |||
Physicochemical properties | |||
Number of amino acids: | 111 | ||
Molecular weight: | 12,470.767 | ||
Theoretical pI: | 11.856 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 114.768 | ||
aromaticity | 0.027 | ||
GRAVY | -1.282 | ||
Secondary Structure Fraction | |||
Helix | 0.144 | ||
turn | 0.288 | ||
sheet | 0.252 |