| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336616.1 | 5prime_partial | 215 | 728-81(-) |
Amino Acid sequence : | |||
| INEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRDELDTVLGPGVQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPAQW KKPEEFRPERFLEEEAKVEANGNDFRYLPFGVGRRSCPGIILASPILGITLGRLVQNFELLPPPGQSKIDTTEKGGQFSLHILKHSTIVLKPRSV* | |||
Physicochemical properties | |||
| Number of amino acids: | 215 | ||
| Molecular weight: | 12,889.797 | ||
| Theoretical pI: | 7.819 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
| Instability index: | 54.828 | ||
| aromaticity | 0.052 | ||
| GRAVY | -0.164 | ||
Secondary Structure Fraction | |||
| Helix | 0.322 | ||
| turn | 0.217 | ||
| sheet | 0.322 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336616.1 | complete | 115 | 114-461(+) |
Amino Acid sequence : | |||
| MLQNVKTELPTFLRRIDLRLPRWRQQLEVLYESAQRNTQNRRCKDNTRAAPSANAEGEVPKVIAIGLDFSLLFQESLGPELLGLFPLGRVVGQPPRIHQDLALGGDVVAAELCIM* | |||
Physicochemical properties | |||
| Number of amino acids: | 115 | ||
| Molecular weight: | 12,889.797 | ||
| Theoretical pI: | 7.819 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
| Instability index: | 54.828 | ||
| aromaticity | 0.052 | ||
| GRAVY | -0.164 | ||
Secondary Structure Fraction | |||
| Helix | 0.322 | ||
| turn | 0.217 | ||
| sheet | 0.322 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336616.1 | 5prime_partial | 215 | 728-81(-) |
Amino Acid sequence : | |||
| INEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRDELDTVLGPGVQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPAQW KKPEEFRPERFLEEEAKVEANGNDFRYLPFGVGRRSCPGIILASPILGITLGRLVQNFELLPPPGQSKIDTTEKGGQFSLHILKHSTIVLKPRSV* | |||
Physicochemical properties | |||
| Number of amino acids: | 215 | ||
| Molecular weight: | 12,889.797 | ||
| Theoretical pI: | 7.819 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
| Instability index: | 54.828 | ||
| aromaticity | 0.052 | ||
| GRAVY | -0.164 | ||
Secondary Structure Fraction | |||
| Helix | 0.322 | ||
| turn | 0.217 | ||
| sheet | 0.322 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336616.1 | complete | 115 | 114-461(+) |
Amino Acid sequence : | |||
| MLQNVKTELPTFLRRIDLRLPRWRQQLEVLYESAQRNTQNRRCKDNTRAAPSANAEGEVPKVIAIGLDFSLLFQESLGPELLGLFPLGRVVGQPPRIHQDLALGGDVVAAELCIM* | |||
Physicochemical properties | |||
| Number of amino acids: | 115 | ||
| Molecular weight: | 12,889.797 | ||
| Theoretical pI: | 7.819 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
| Instability index: | 54.828 | ||
| aromaticity | 0.052 | ||
| GRAVY | -0.164 | ||
Secondary Structure Fraction | |||
| Helix | 0.322 | ||
| turn | 0.217 | ||
| sheet | 0.322 | ||