Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336619.1 | complete | 196 | 72-662(+) |
Amino Acid sequence : | |||
MASTLFSGLKYSDSLTVVGISFCTAVVCEAISWLLIYRTASYKSLKSSIDKASKKLETMKTTDSNYASANVLKKSSKTKKIDRVETSLKESSRDLSMFKFKSGGVVALVLFMVFGLLNSL FEGKPVAKIPFVPIRLVQKMSHRGLAGDDMTDCSMAFLYFLCSISIRTNLQKFLGFSPPRGAAGAGLFPMPDPKSN* | |||
Physicochemical properties | |||
Number of amino acids: | 196 | ||
Molecular weight: | 13,778.840 | ||
Theoretical pI: | 9.754 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
Instability index: | 55.345 | ||
aromaticity | 0.073 | ||
GRAVY | -0.231 | ||
Secondary Structure Fraction | |||
Helix | 0.282 | ||
turn | 0.298 | ||
sheet | 0.274 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336619.1 | complete | 124 | 640-266(-) |
Amino Acid sequence : | |||
MGNKPAPAAPRGGENPKNFCKLVLMLIEHRKYKNAIEQSVISSPANPLWLIFCTNLIGTNGILATGFPSNKLLSSPKTMNRTRATTPPDLNLNMDRSRLDSFKEVSTRSIFLVLEDFLRT FAEA* | |||
Physicochemical properties | |||
Number of amino acids: | 124 | ||
Molecular weight: | 13,778.840 | ||
Theoretical pI: | 9.754 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
Instability index: | 55.345 | ||
aromaticity | 0.073 | ||
GRAVY | -0.231 | ||
Secondary Structure Fraction | |||
Helix | 0.282 | ||
turn | 0.298 | ||
sheet | 0.274 |