| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336621.1 | complete | 224 | 810-136(-) |
Amino Acid sequence : | |||
| MIEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRDELDTVLGPGVQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAW WLANNPAQWKKPEEFRPERFLEEEAKVEANGNDFRYLPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKIDTTEKGGQFSLHILKHSTIVLKPRSV* | |||
Physicochemical properties | |||
| Number of amino acids: | 224 | ||
| Molecular weight: | 12,758.619 | ||
| Theoretical pI: | 6.571 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
| Instability index: | 48.497 | ||
| aromaticity | 0.043 | ||
| GRAVY | -0.181 | ||
Secondary Structure Fraction | |||
| Helix | 0.313 | ||
| turn | 0.235 | ||
| sheet | 0.313 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336621.1 | complete | 115 | 169-516(+) |
Amino Acid sequence : | |||
| MLQNVKTELPTFLRRIDLRLPRGRQQLEVLYESAQRNTQNRQCKDNTRAAPSANAEGEVPKVIAIGLDFSLLFQESLGPELLGLFPLGRVVGQPPRIHQDLALGGDVVPAELCIM* | |||
Physicochemical properties | |||
| Number of amino acids: | 115 | ||
| Molecular weight: | 12,758.619 | ||
| Theoretical pI: | 6.571 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
| Instability index: | 48.497 | ||
| aromaticity | 0.043 | ||
| GRAVY | -0.181 | ||
Secondary Structure Fraction | |||
| Helix | 0.313 | ||
| turn | 0.235 | ||
| sheet | 0.313 | ||