| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336627.1 | complete | 171 | 100-615(+) |
Amino Acid sequence : | |||
| MFGYATDETPELMPLTHVLATKLGAKLTEVRKNKTCPWLIPDGKTQVTVEYKNEEGAMVPVRVHTVLVSTQHDETVTNDQIAADLKEHVIKPVIPAQYLDDKTIFHLNPSGRFVIGGPHG DAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIVRQAAKSVVAS* | |||
Physicochemical properties | |||
| Number of amino acids: | 171 | ||
| Molecular weight: | 12,770.358 | ||
| Theoretical pI: | 4.648 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 18240 | ||
| Instability index: | 34.731 | ||
| aromaticity | 0.080 | ||
| GRAVY | 0.068 | ||
Secondary Structure Fraction | |||
| Helix | 0.363 | ||
| turn | 0.221 | ||
| sheet | 0.195 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336627.1 | complete | 113 | 519-178(-) |
Amino Acid sequence : | |||
| MSTPATICVDDDLPTSETGISMWTTNHETPRWVKVEDCLIIEILSRNHRLDDVLFQVSCNLVIRDSLIVLRGDEDCVNSHRNHGTFLVFVLDGDLGFTIGYQPWASLVLPHFS* | |||
Physicochemical properties | |||
| Number of amino acids: | 113 | ||
| Molecular weight: | 12,770.358 | ||
| Theoretical pI: | 4.648 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 18240 | ||
| Instability index: | 34.731 | ||
| aromaticity | 0.080 | ||
| GRAVY | 0.068 | ||
Secondary Structure Fraction | |||
| Helix | 0.363 | ||
| turn | 0.221 | ||
| sheet | 0.195 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336627.1 | complete | 171 | 100-615(+) |
Amino Acid sequence : | |||
| MFGYATDETPELMPLTHVLATKLGAKLTEVRKNKTCPWLIPDGKTQVTVEYKNEEGAMVPVRVHTVLVSTQHDETVTNDQIAADLKEHVIKPVIPAQYLDDKTIFHLNPSGRFVIGGPHG DAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIVRQAAKSVVAS* | |||
Physicochemical properties | |||
| Number of amino acids: | 171 | ||
| Molecular weight: | 12,770.358 | ||
| Theoretical pI: | 4.648 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 18240 | ||
| Instability index: | 34.731 | ||
| aromaticity | 0.080 | ||
| GRAVY | 0.068 | ||
Secondary Structure Fraction | |||
| Helix | 0.363 | ||
| turn | 0.221 | ||
| sheet | 0.195 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336627.1 | complete | 113 | 519-178(-) |
Amino Acid sequence : | |||
| MSTPATICVDDDLPTSETGISMWTTNHETPRWVKVEDCLIIEILSRNHRLDDVLFQVSCNLVIRDSLIVLRGDEDCVNSHRNHGTFLVFVLDGDLGFTIGYQPWASLVLPHFS* | |||
Physicochemical properties | |||
| Number of amino acids: | 113 | ||
| Molecular weight: | 12,770.358 | ||
| Theoretical pI: | 4.648 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 18240 | ||
| Instability index: | 34.731 | ||
| aromaticity | 0.080 | ||
| GRAVY | 0.068 | ||
Secondary Structure Fraction | |||
| Helix | 0.363 | ||
| turn | 0.221 | ||
| sheet | 0.195 | ||