| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336635.1 | 5prime_partial | 204 | 678-64(-) |
Amino Acid sequence : | |||
| DKLLTAVSACTPVTEAFSLVEDILRQGVRGICDIITIPGLVNVDFADVRTVMASAGSSLMGIGTATGKTRARDDALNAIQSPFLDIGIERASGIVWNITGGSDLTLFEVNAAAEVIYDLV DPSANLIFGAVIDPSMSGQASITLIANGFKRQEESDGRIPQANQTGHGDSNMGVNRGASSFLEGSFVEIPEFLRKKGRYRYPRA* | |||
Physicochemical properties | |||
| Number of amino acids: | 204 | ||
| Molecular weight: | 21,638.217 | ||
| Theoretical pI: | 4.821 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
| Instability index: | 35.576 | ||
| aromaticity | 0.064 | ||
| GRAVY | 0.053 | ||
Secondary Structure Fraction | |||
| Helix | 0.299 | ||
| turn | 0.270 | ||
| sheet | 0.245 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336635.1 | 5prime_partial | 204 | 678-64(-) |
Amino Acid sequence : | |||
| DKLLTAVSACTPVTEAFSLVEDILRQGVRGICDIITIPGLVNVDFADVRTVMASAGSSLMGIGTATGKTRARDDALNAIQSPFLDIGIERASGIVWNITGGSDLTLFEVNAAAEVIYDLV DPSANLIFGAVIDPSMSGQASITLIANGFKRQEESDGRIPQANQTGHGDSNMGVNRGASSFLEGSFVEIPEFLRKKGRYRYPRA* | |||
Physicochemical properties | |||
| Number of amino acids: | 204 | ||
| Molecular weight: | 21,638.217 | ||
| Theoretical pI: | 4.821 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
| Instability index: | 35.576 | ||
| aromaticity | 0.064 | ||
| GRAVY | 0.053 | ||
Secondary Structure Fraction | |||
| Helix | 0.299 | ||
| turn | 0.270 | ||
| sheet | 0.245 | ||