| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336642.1 | 5prime_partial | 150 | 509-57(-) |
Amino Acid sequence : | |||
| PSKEIENGCLWEVEGKWVVKGSVDVAIGATPSAEGGDEDEGVAAQAVKVVAIVDPFRLQEHPPFAKKQFIGYMKKYIKPPSGKLEGEHLDAFKKGFEGAPKYLLGKLKDLQFFVGETMPD DSSLVFAYSKGGPPDPPFLYLAQGWKEIKC* | |||
Physicochemical properties | |||
| Number of amino acids: | 150 | ||
| Molecular weight: | 12,468.073 | ||
| Theoretical pI: | 9.099 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15720 | ||
| Instability index: | 65.620 | ||
| aromaticity | 0.110 | ||
| GRAVY | -0.039 | ||
Secondary Structure Fraction | |||
| Helix | 0.237 | ||
| turn | 0.407 | ||
| sheet | 0.220 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336642.1 | 3prime_partial | 118 | 157-510(+) |
Amino Acid sequence : | |||
| MVSPTKNWRSLSLPSRYLGAPSKPFLNASRCSPSSFPLGGLMYFFIYPINCFLAKGGCSCNLNGSTMATTFTAWAATPSSSSPPSAEGVAPMATSTEPLTTHFPSTSHKHPFSISLDG | |||
Physicochemical properties | |||
| Number of amino acids: | 118 | ||
| Molecular weight: | 12,468.073 | ||
| Theoretical pI: | 9.099 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15720 | ||
| Instability index: | 65.620 | ||
| aromaticity | 0.110 | ||
| GRAVY | -0.039 | ||
Secondary Structure Fraction | |||
| Helix | 0.237 | ||
| turn | 0.407 | ||
| sheet | 0.220 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336642.1 | 5prime_partial | 150 | 509-57(-) |
Amino Acid sequence : | |||
| PSKEIENGCLWEVEGKWVVKGSVDVAIGATPSAEGGDEDEGVAAQAVKVVAIVDPFRLQEHPPFAKKQFIGYMKKYIKPPSGKLEGEHLDAFKKGFEGAPKYLLGKLKDLQFFVGETMPD DSSLVFAYSKGGPPDPPFLYLAQGWKEIKC* | |||
Physicochemical properties | |||
| Number of amino acids: | 150 | ||
| Molecular weight: | 12,468.073 | ||
| Theoretical pI: | 9.099 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15720 | ||
| Instability index: | 65.620 | ||
| aromaticity | 0.110 | ||
| GRAVY | -0.039 | ||
Secondary Structure Fraction | |||
| Helix | 0.237 | ||
| turn | 0.407 | ||
| sheet | 0.220 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336642.1 | 3prime_partial | 118 | 157-510(+) |
Amino Acid sequence : | |||
| MVSPTKNWRSLSLPSRYLGAPSKPFLNASRCSPSSFPLGGLMYFFIYPINCFLAKGGCSCNLNGSTMATTFTAWAATPSSSSPPSAEGVAPMATSTEPLTTHFPSTSHKHPFSISLDG | |||
Physicochemical properties | |||
| Number of amino acids: | 118 | ||
| Molecular weight: | 12,468.073 | ||
| Theoretical pI: | 9.099 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15720 | ||
| Instability index: | 65.620 | ||
| aromaticity | 0.110 | ||
| GRAVY | -0.039 | ||
Secondary Structure Fraction | |||
| Helix | 0.237 | ||
| turn | 0.407 | ||
| sheet | 0.220 | ||