Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336652.1 | 5prime_partial | 167 | 2-505(+) |
Amino Acid sequence : | |||
QLTNTHYSFRTLCILDFQYLILKERMAVAMGCARSWPQFKESSSSSNINCNVKGFRVSCVASSTLTDPYKTLSLRPGASESEVKKAFRQLAKKYHPDVCRGSNCGIQFHEINEAYDVVMS NLRGDTSTEMYDEDDSMRDEDWELWEEWVGWEGAGIRDYSSHINPYI* | |||
Physicochemical properties | |||
Number of amino acids: | 167 | ||
Molecular weight: | 11,446.530 | ||
Theoretical pI: | 9.892 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
Instability index: | 56.148 | ||
aromaticity | 0.098 | ||
GRAVY | 0.491 | ||
Secondary Structure Fraction | |||
Helix | 0.392 | ||
turn | 0.275 | ||
sheet | 0.206 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336652.1 | complete | 102 | 523-215(-) |
Amino Acid sequence : | |||
MNVNKILDVGVDMRGVITNSSSFPPHPFFPQLPILIPHRIIFIIHLRRCIPSQITHYNIVCFVNFMELDAAIASSANIWMILFGKLPKSLLNLGFRSTGAKA* | |||
Physicochemical properties | |||
Number of amino acids: | 102 | ||
Molecular weight: | 11,446.530 | ||
Theoretical pI: | 9.892 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
Instability index: | 56.148 | ||
aromaticity | 0.098 | ||
GRAVY | 0.491 | ||
Secondary Structure Fraction | |||
Helix | 0.392 | ||
turn | 0.275 | ||
sheet | 0.206 |