| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336652.1 | 5prime_partial | 167 | 2-505(+) |
Amino Acid sequence : | |||
| QLTNTHYSFRTLCILDFQYLILKERMAVAMGCARSWPQFKESSSSSNINCNVKGFRVSCVASSTLTDPYKTLSLRPGASESEVKKAFRQLAKKYHPDVCRGSNCGIQFHEINEAYDVVMS NLRGDTSTEMYDEDDSMRDEDWELWEEWVGWEGAGIRDYSSHINPYI* | |||
Physicochemical properties | |||
| Number of amino acids: | 167 | ||
| Molecular weight: | 11,446.530 | ||
| Theoretical pI: | 9.892 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
| Instability index: | 56.148 | ||
| aromaticity | 0.098 | ||
| GRAVY | 0.491 | ||
Secondary Structure Fraction | |||
| Helix | 0.392 | ||
| turn | 0.275 | ||
| sheet | 0.206 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336652.1 | complete | 102 | 523-215(-) |
Amino Acid sequence : | |||
| MNVNKILDVGVDMRGVITNSSSFPPHPFFPQLPILIPHRIIFIIHLRRCIPSQITHYNIVCFVNFMELDAAIASSANIWMILFGKLPKSLLNLGFRSTGAKA* | |||
Physicochemical properties | |||
| Number of amino acids: | 102 | ||
| Molecular weight: | 11,446.530 | ||
| Theoretical pI: | 9.892 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
| Instability index: | 56.148 | ||
| aromaticity | 0.098 | ||
| GRAVY | 0.491 | ||
Secondary Structure Fraction | |||
| Helix | 0.392 | ||
| turn | 0.275 | ||
| sheet | 0.206 | ||