Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336653.1 | 5prime_partial | 167 | 600-97(-) |
Amino Acid sequence : | |||
RLTNTHYSFRTLCILDFQYLILKERMAVAMGCGRSWPQFKESSSSSNINCNVKGFRVSCVVFSTLTDPYKTLSLRPGAFESEVKKAFRQLAKKYHPDVCRGSNCGIQFHEINEAYDVVMS NLRGDTFTEMYDEDDSMRDEDWELWEEWVGWEGAGIRDYSSHINPYI* | |||
Physicochemical properties | |||
Number of amino acids: | 167 | ||
Molecular weight: | 12,982.402 | ||
Theoretical pI: | 9.955 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
Instability index: | 44.073 | ||
aromaticity | 0.094 | ||
GRAVY | 0.463 | ||
Secondary Structure Fraction | |||
Helix | 0.385 | ||
turn | 0.291 | ||
sheet | 0.188 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336653.1 | complete | 117 | 34-387(+) |
Amino Acid sequence : | |||
MYRNVKGVGGCTINVMNVNKILNVGVDMRGVITNSSSFPPHPFFPQLPILIPHRIIFIIHLRKCIPSQITHYNIVCFVNFMELDAAIASSANIWMILFGKLPKSLLNLGFKSTGAKA* | |||
Physicochemical properties | |||
Number of amino acids: | 117 | ||
Molecular weight: | 12,982.402 | ||
Theoretical pI: | 9.955 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
Instability index: | 44.073 | ||
aromaticity | 0.094 | ||
GRAVY | 0.463 | ||
Secondary Structure Fraction | |||
Helix | 0.385 | ||
turn | 0.291 | ||
sheet | 0.188 |