| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336653.1 | 5prime_partial | 167 | 600-97(-) |
Amino Acid sequence : | |||
| RLTNTHYSFRTLCILDFQYLILKERMAVAMGCGRSWPQFKESSSSSNINCNVKGFRVSCVVFSTLTDPYKTLSLRPGAFESEVKKAFRQLAKKYHPDVCRGSNCGIQFHEINEAYDVVMS NLRGDTFTEMYDEDDSMRDEDWELWEEWVGWEGAGIRDYSSHINPYI* | |||
Physicochemical properties | |||
| Number of amino acids: | 167 | ||
| Molecular weight: | 12,982.402 | ||
| Theoretical pI: | 9.955 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 44.073 | ||
| aromaticity | 0.094 | ||
| GRAVY | 0.463 | ||
Secondary Structure Fraction | |||
| Helix | 0.385 | ||
| turn | 0.291 | ||
| sheet | 0.188 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336653.1 | complete | 117 | 34-387(+) |
Amino Acid sequence : | |||
| MYRNVKGVGGCTINVMNVNKILNVGVDMRGVITNSSSFPPHPFFPQLPILIPHRIIFIIHLRKCIPSQITHYNIVCFVNFMELDAAIASSANIWMILFGKLPKSLLNLGFKSTGAKA* | |||
Physicochemical properties | |||
| Number of amino acids: | 117 | ||
| Molecular weight: | 12,982.402 | ||
| Theoretical pI: | 9.955 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 44.073 | ||
| aromaticity | 0.094 | ||
| GRAVY | 0.463 | ||
Secondary Structure Fraction | |||
| Helix | 0.385 | ||
| turn | 0.291 | ||
| sheet | 0.188 | ||