| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336655.1 | internal | 265 | 2-796(+) |
Amino Acid sequence : | |||
| HDASCRIRHEADLLEYGDPNNIVVYLHATVQRILFETSPGKKAKAYGVIFEDSKGQNHTAMLNNGGTNEIILSAGALGSPQLLMLSGIGPGPKLKARGIDIVLDQPMVGQGMSDNPLNAF IIPTRKVVDTSLAQVVGITRVGVYIESFSGQFIIPRVDRRYTNQNFDSMEVAYEKLENGYALLGQKIAKPISTGYLELNGTNPSENPSVTFNYFNDSRDLQTCVDGFKILQGVVESRSIS DYRYPNSSIESLKRFMLSLHINLRR | |||
Physicochemical properties | |||
| Number of amino acids: | 265 | ||
| Molecular weight: | 29,285.967 | ||
| Theoretical pI: | 7.139 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16390 16515 | ||
| Instability index: | 29.228 | ||
| aromaticity | 0.079 | ||
| GRAVY | -0.234 | ||
Secondary Structure Fraction | |||
| Helix | 0.321 | ||
| turn | 0.287 | ||
| sheet | 0.219 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336655.1 | internal | 265 | 2-796(+) |
Amino Acid sequence : | |||
| HDASCRIRHEADLLEYGDPNNIVVYLHATVQRILFETSPGKKAKAYGVIFEDSKGQNHTAMLNNGGTNEIILSAGALGSPQLLMLSGIGPGPKLKARGIDIVLDQPMVGQGMSDNPLNAF IIPTRKVVDTSLAQVVGITRVGVYIESFSGQFIIPRVDRRYTNQNFDSMEVAYEKLENGYALLGQKIAKPISTGYLELNGTNPSENPSVTFNYFNDSRDLQTCVDGFKILQGVVESRSIS DYRYPNSSIESLKRFMLSLHINLRR | |||
Physicochemical properties | |||
| Number of amino acids: | 265 | ||
| Molecular weight: | 29,285.967 | ||
| Theoretical pI: | 7.139 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16390 16515 | ||
| Instability index: | 29.228 | ||
| aromaticity | 0.079 | ||
| GRAVY | -0.234 | ||
Secondary Structure Fraction | |||
| Helix | 0.321 | ||
| turn | 0.287 | ||
| sheet | 0.219 | ||