| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336659.1 | internal | 257 | 2-772(+) |
Amino Acid sequence : | |||
| DKEVQLHAQAWEHALSYINSTALSAAVELEIPDILEDHGGLMSLSELSAASGCPREPLYRLMRFLIFHGIFTKSDDCYAQSPLSRLFTRENLGPYMLMQATPVTRSPAGLSGEALKTGTS LYLKSIRGEDSWSDPAYGYHMKAFTNAMIAHARLTAAAIVSNYPAAFDGLRSVVDVGGRHGTAIGRLVEAFPWVRGIAFDLPEIVADAPPRKGVDFVGGDMFESVPKADAVMLMWILHDW SDNKCIEILKKCKEAIP | |||
Physicochemical properties | |||
| Number of amino acids: | 257 | ||
| Molecular weight: | 12,416.948 | ||
| Theoretical pI: | 11.855 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
| Instability index: | 100.890 | ||
| aromaticity | 0.117 | ||
| GRAVY | -0.957 | ||
Secondary Structure Fraction | |||
| Helix | 0.272 | ||
| turn | 0.223 | ||
| sheet | 0.136 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336659.1 | 5prime_partial | 128 | 1-387(+) |
Amino Acid sequence : | |||
| RQRSSTSCTSMGARPKLHQLHGAVCGGGAGDSRHPGRSRRPDVAVGALRRLRLPPRAALPPHEIPHLPRHLHQIRRLLRPVAAFSAFHERESGTLHVDAGDAGNEVSCGLERRSLENGDK PLSQVDQR* | |||
Physicochemical properties | |||
| Number of amino acids: | 128 | ||
| Molecular weight: | 12,416.948 | ||
| Theoretical pI: | 11.855 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
| Instability index: | 100.890 | ||
| aromaticity | 0.117 | ||
| GRAVY | -0.957 | ||
Secondary Structure Fraction | |||
| Helix | 0.272 | ||
| turn | 0.223 | ||
| sheet | 0.136 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336659.1 | complete | 125 | 421-44(-) |
Amino Acid sequence : | |||
| MVAVGRVAPRILTSDRLEIKACPRFQGFAAQARRRPRYRRRLHQHVGSQILSREKPRKRRLGVAVVGFGEDAVEDEESHEAVERLAGAAGGGGELRQRHQAAVIFQDVGNLQLHRRRQRR GVDVT* | |||
Physicochemical properties | |||
| Number of amino acids: | 125 | ||
| Molecular weight: | 12,416.948 | ||
| Theoretical pI: | 11.855 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
| Instability index: | 100.890 | ||
| aromaticity | 0.117 | ||
| GRAVY | -0.957 | ||
Secondary Structure Fraction | |||
| Helix | 0.272 | ||
| turn | 0.223 | ||
| sheet | 0.136 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336659.1 | 5prime_partial | 103 | 772-461(-) |
Amino Acid sequence : | |||
| WNRFFAFLQNFYAFIVAPVMQYPHEHDRVGFRHAFKHVPSDEVDPFTRRSIRHNLRQIKRNSPHPRKRLHQSPDSRSVAAAHIHHRSQSVKRRRIVAYNGSRR* | |||
Physicochemical properties | |||
| Number of amino acids: | 103 | ||
| Molecular weight: | 12,416.948 | ||
| Theoretical pI: | 11.855 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
| Instability index: | 100.890 | ||
| aromaticity | 0.117 | ||
| GRAVY | -0.957 | ||
Secondary Structure Fraction | |||
| Helix | 0.272 | ||
| turn | 0.223 | ||
| sheet | 0.136 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336659.1 | internal | 257 | 2-772(+) |
Amino Acid sequence : | |||
| DKEVQLHAQAWEHALSYINSTALSAAVELEIPDILEDHGGLMSLSELSAASGCPREPLYRLMRFLIFHGIFTKSDDCYAQSPLSRLFTRENLGPYMLMQATPVTRSPAGLSGEALKTGTS LYLKSIRGEDSWSDPAYGYHMKAFTNAMIAHARLTAAAIVSNYPAAFDGLRSVVDVGGRHGTAIGRLVEAFPWVRGIAFDLPEIVADAPPRKGVDFVGGDMFESVPKADAVMLMWILHDW SDNKCIEILKKCKEAIP | |||
Physicochemical properties | |||
| Number of amino acids: | 257 | ||
| Molecular weight: | 12,416.948 | ||
| Theoretical pI: | 11.855 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
| Instability index: | 100.890 | ||
| aromaticity | 0.117 | ||
| GRAVY | -0.957 | ||
Secondary Structure Fraction | |||
| Helix | 0.272 | ||
| turn | 0.223 | ||
| sheet | 0.136 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336659.1 | 5prime_partial | 128 | 1-387(+) |
Amino Acid sequence : | |||
| RQRSSTSCTSMGARPKLHQLHGAVCGGGAGDSRHPGRSRRPDVAVGALRRLRLPPRAALPPHEIPHLPRHLHQIRRLLRPVAAFSAFHERESGTLHVDAGDAGNEVSCGLERRSLENGDK PLSQVDQR* | |||
Physicochemical properties | |||
| Number of amino acids: | 128 | ||
| Molecular weight: | 12,416.948 | ||
| Theoretical pI: | 11.855 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
| Instability index: | 100.890 | ||
| aromaticity | 0.117 | ||
| GRAVY | -0.957 | ||
Secondary Structure Fraction | |||
| Helix | 0.272 | ||
| turn | 0.223 | ||
| sheet | 0.136 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336659.1 | complete | 125 | 421-44(-) |
Amino Acid sequence : | |||
| MVAVGRVAPRILTSDRLEIKACPRFQGFAAQARRRPRYRRRLHQHVGSQILSREKPRKRRLGVAVVGFGEDAVEDEESHEAVERLAGAAGGGGELRQRHQAAVIFQDVGNLQLHRRRQRR GVDVT* | |||
Physicochemical properties | |||
| Number of amino acids: | 125 | ||
| Molecular weight: | 12,416.948 | ||
| Theoretical pI: | 11.855 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
| Instability index: | 100.890 | ||
| aromaticity | 0.117 | ||
| GRAVY | -0.957 | ||
Secondary Structure Fraction | |||
| Helix | 0.272 | ||
| turn | 0.223 | ||
| sheet | 0.136 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336659.1 | 5prime_partial | 103 | 772-461(-) |
Amino Acid sequence : | |||
| WNRFFAFLQNFYAFIVAPVMQYPHEHDRVGFRHAFKHVPSDEVDPFTRRSIRHNLRQIKRNSPHPRKRLHQSPDSRSVAAAHIHHRSQSVKRRRIVAYNGSRR* | |||
Physicochemical properties | |||
| Number of amino acids: | 103 | ||
| Molecular weight: | 12,416.948 | ||
| Theoretical pI: | 11.855 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
| Instability index: | 100.890 | ||
| aromaticity | 0.117 | ||
| GRAVY | -0.957 | ||
Secondary Structure Fraction | |||
| Helix | 0.272 | ||
| turn | 0.223 | ||
| sheet | 0.136 | ||