Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336667.1 | complete | 172 | 27-545(+) |
Amino Acid sequence : | |||
MPFYPLTLVPLFGPILGPLLGPILGQPAPPIVPPVGQVPPVRVGQLPILGPILGPILGPILGPILGQPIVPPTNTPPILPPIVPPVGQVPPIVPPIVPPVINLTILGSLSCSVPGSNAPG PGVSGANVTIICGNTTIAQVSTNSQGIINAAWSTNTSPFVKNMYCKDSSPNC* | |||
Physicochemical properties | |||
Number of amino acids: | 172 | ||
Molecular weight: | 17,353.503 | ||
Theoretical pI: | 8.473 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8730 | ||
Instability index: | 61.085 | ||
aromaticity | 0.035 | ||
GRAVY | 0.583 | ||
Secondary Structure Fraction | |||
Helix | 0.355 | ||
turn | 0.453 | ||
sheet | 0.145 |