| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336667.1 | complete | 172 | 27-545(+) |
Amino Acid sequence : | |||
| MPFYPLTLVPLFGPILGPLLGPILGQPAPPIVPPVGQVPPVRVGQLPILGPILGPILGPILGPILGQPIVPPTNTPPILPPIVPPVGQVPPIVPPIVPPVINLTILGSLSCSVPGSNAPG PGVSGANVTIICGNTTIAQVSTNSQGIINAAWSTNTSPFVKNMYCKDSSPNC* | |||
Physicochemical properties | |||
| Number of amino acids: | 172 | ||
| Molecular weight: | 17,353.503 | ||
| Theoretical pI: | 8.473 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8730 | ||
| Instability index: | 61.085 | ||
| aromaticity | 0.035 | ||
| GRAVY | 0.583 | ||
Secondary Structure Fraction | |||
| Helix | 0.355 | ||
| turn | 0.453 | ||
| sheet | 0.145 | ||