Acc_NO	ORF type	length	start-end position (strand +/-)
>DY336680.1	5prime_partial	165	2-499(+)
Amino Acid sequence :
PLTQKTQPQKSPPNFLRRREMSSEQIESHRANAEVYTGDAVCKQKSIELLEKINMPKGLLPLDDIVEVGHNAETGFVWLKQKKSKTHYFKGIGRSVWYDTEVTAFVSDRRMKRLTGVKSK EILIWITICDISIKDPESGKITFGTPTGISRAFPVSAFEEEEEKK*
Physicochemical properties
Number of amino acids:		165
Molecular weight:		18,798.349
Theoretical pI:		9.048
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		20970 21095
Instability index:		63.005
aromaticity		0.079
GRAVY		-0.595
Secondary Structure Fraction
Helix		0.279
turn		0.218
sheet		0.218