| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336683.1 | complete | 199 | 90-689(+) |
Amino Acid sequence : | |||
| MTLQFYKDTNQQKFLTRHVADSIPFSSDKLPEIYTKFLVDPDSDEAEAMKKTIQECEEKGIKGEEKVCATSLESMVDFATSKIGNNVEAVSTEADSSDRKVYRIERVSRKPSDKPVVVCH QQEYEYAVFYCHKTETTVAYDVSLVGAGGSKAEAVAVCHRDTAEWNPKHLAFQVLKVKPGTVPVCHYLPENHIVWVSKN* | |||
Physicochemical properties | |||
| Number of amino acids: | 199 | ||
| Molecular weight: | 15,498.240 | ||
| Theoretical pI: | 10.055 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17335 | ||
| Instability index: | 70.229 | ||
| aromaticity | 0.056 | ||
| GRAVY | -1.108 | ||
Secondary Structure Fraction | |||
| Helix | 0.134 | ||
| turn | 0.423 | ||
| sheet | 0.155 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336683.1 | 5prime_partial | 142 | 723-295(-) |
Amino Acid sequence : | |||
| KPHMKSMLNYSSNSSKPTQCDSQGDNGRLAQSLASPSTPEKPNASGSTLPCPCGTPPQPQPLTHRPPREKRRRPPSSQSCGSKTQHTHTPAGGKPPPACRSASSTPFQYGTLSYPNYPLL STLLQRCSLFSTWRNRPWTPEK* | |||
Physicochemical properties | |||
| Number of amino acids: | 142 | ||
| Molecular weight: | 15,498.240 | ||
| Theoretical pI: | 10.055 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17335 | ||
| Instability index: | 70.229 | ||
| aromaticity | 0.056 | ||
| GRAVY | -1.108 | ||
Secondary Structure Fraction | |||
| Helix | 0.134 | ||
| turn | 0.423 | ||
| sheet | 0.155 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336683.1 | complete | 199 | 90-689(+) |
Amino Acid sequence : | |||
| MTLQFYKDTNQQKFLTRHVADSIPFSSDKLPEIYTKFLVDPDSDEAEAMKKTIQECEEKGIKGEEKVCATSLESMVDFATSKIGNNVEAVSTEADSSDRKVYRIERVSRKPSDKPVVVCH QQEYEYAVFYCHKTETTVAYDVSLVGAGGSKAEAVAVCHRDTAEWNPKHLAFQVLKVKPGTVPVCHYLPENHIVWVSKN* | |||
Physicochemical properties | |||
| Number of amino acids: | 199 | ||
| Molecular weight: | 15,498.240 | ||
| Theoretical pI: | 10.055 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17335 | ||
| Instability index: | 70.229 | ||
| aromaticity | 0.056 | ||
| GRAVY | -1.108 | ||
Secondary Structure Fraction | |||
| Helix | 0.134 | ||
| turn | 0.423 | ||
| sheet | 0.155 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336683.1 | 5prime_partial | 142 | 723-295(-) |
Amino Acid sequence : | |||
| KPHMKSMLNYSSNSSKPTQCDSQGDNGRLAQSLASPSTPEKPNASGSTLPCPCGTPPQPQPLTHRPPREKRRRPPSSQSCGSKTQHTHTPAGGKPPPACRSASSTPFQYGTLSYPNYPLL STLLQRCSLFSTWRNRPWTPEK* | |||
Physicochemical properties | |||
| Number of amino acids: | 142 | ||
| Molecular weight: | 15,498.240 | ||
| Theoretical pI: | 10.055 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17335 | ||
| Instability index: | 70.229 | ||
| aromaticity | 0.056 | ||
| GRAVY | -1.108 | ||
Secondary Structure Fraction | |||
| Helix | 0.134 | ||
| turn | 0.423 | ||
| sheet | 0.155 | ||