| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336684.1 | complete | 181 | 123-668(+) |
Amino Acid sequence : | |||
| MKERPHITITSPIDTYHTHRQISDSQEYVKDTCTHILKSKPHMKSMLNYSSNSSKPTQCDSQGDNGRLAQSLASPSTPEKPNASGSTLPCPCGTPPQPQPLTHRPPREKRRRPPSSQSCG SKTQHTHTPAGGKPPPACRSASSTPFQYGTLSYPNYPLLSTLLQRCSLFSTWRNRPWTPEK* | |||
Physicochemical properties | |||
| Number of amino acids: | 181 | ||
| Molecular weight: | 17,116.225 | ||
| Theoretical pI: | 6.337 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20315 | ||
| Instability index: | 42.841 | ||
| aromaticity | 0.071 | ||
| GRAVY | -0.414 | ||
Secondary Structure Fraction | |||
| Helix | 0.273 | ||
| turn | 0.188 | ||
| sheet | 0.240 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336684.1 | 5prime_partial | 154 | 738-274(-) |
Amino Acid sequence : | |||
| AEAMKKTIQECEEKGIKGEEKVCATSLESMVDFATSKIGNNVEAVSTEADSSDRKVYRIERVSRKPSDKPVVVCHQQEYEYAVFYCHKTETTVAYDVSLVGAGGSKAEAVAVCHRDTAEW NPKHLAFQVLKVKPGTVPVCHYLPENHIVWVSKN* | |||
Physicochemical properties | |||
| Number of amino acids: | 154 | ||
| Molecular weight: | 17,116.225 | ||
| Theoretical pI: | 6.337 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20315 | ||
| Instability index: | 42.841 | ||
| aromaticity | 0.071 | ||
| GRAVY | -0.414 | ||
Secondary Structure Fraction | |||
| Helix | 0.273 | ||
| turn | 0.188 | ||
| sheet | 0.240 | ||