Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336684.1 | complete | 181 | 123-668(+) |
Amino Acid sequence : | |||
MKERPHITITSPIDTYHTHRQISDSQEYVKDTCTHILKSKPHMKSMLNYSSNSSKPTQCDSQGDNGRLAQSLASPSTPEKPNASGSTLPCPCGTPPQPQPLTHRPPREKRRRPPSSQSCG SKTQHTHTPAGGKPPPACRSASSTPFQYGTLSYPNYPLLSTLLQRCSLFSTWRNRPWTPEK* | |||
Physicochemical properties | |||
Number of amino acids: | 181 | ||
Molecular weight: | 17,116.225 | ||
Theoretical pI: | 6.337 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20315 | ||
Instability index: | 42.841 | ||
aromaticity | 0.071 | ||
GRAVY | -0.414 | ||
Secondary Structure Fraction | |||
Helix | 0.273 | ||
turn | 0.188 | ||
sheet | 0.240 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336684.1 | 5prime_partial | 154 | 738-274(-) |
Amino Acid sequence : | |||
AEAMKKTIQECEEKGIKGEEKVCATSLESMVDFATSKIGNNVEAVSTEADSSDRKVYRIERVSRKPSDKPVVVCHQQEYEYAVFYCHKTETTVAYDVSLVGAGGSKAEAVAVCHRDTAEW NPKHLAFQVLKVKPGTVPVCHYLPENHIVWVSKN* | |||
Physicochemical properties | |||
Number of amino acids: | 154 | ||
Molecular weight: | 17,116.225 | ||
Theoretical pI: | 6.337 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20315 | ||
Instability index: | 42.841 | ||
aromaticity | 0.071 | ||
GRAVY | -0.414 | ||
Secondary Structure Fraction | |||
Helix | 0.273 | ||
turn | 0.188 | ||
sheet | 0.240 |