Acc_NO	ORF type	length	start-end position (strand +/-)
>DY336686.1	internal	196	3-590(+)
Amino Acid sequence :
FGAASGIGEAAARLFSRHGAKVVIADVQDDVARSICKDLGSTFVHCDVTKESDVEAAVNAAVKTHGTLDIMYNNAGIIESPQFKLLSDFPLSEFNRVVGVNLAGVFLGTKHAARVMIPKR RGSIISTATVASVLGGVGAHAYTASKHGVVGLMKNAAVELGRHGVRVNCVSPYIVATPMTRKFLESSDEGLTDFFY
Physicochemical properties
Number of amino acids:		196
Molecular weight:		11,831.655
Theoretical pI:		8.473
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		9970 10220
Instability index:		62.649
aromaticity		0.092
GRAVY		0.114
Secondary Structure Fraction
Helix		0.248
turn		0.284
sheet		0.275

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY336686.1	5prime_partial	128	590-204(-)
Amino Acid sequence :
IKEIRQPLIAALQEFPRHRGSHDVRRDAVHADAVPPQLHGGVLHQPHHAVLRRGVRVGADAAQHAGDGRRRDDAPPPLGDHHPGGVFRPQKHAGEVHADDAVEFRQREVGEQLELRRLDD AGVVVHDV*
Physicochemical properties
Number of amino acids:		128
Molecular weight:		11,831.655
Theoretical pI:		8.473
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		9970 10220
Instability index:		62.649
aromaticity		0.092
GRAVY		0.114
Secondary Structure Fraction
Helix		0.248
turn		0.284
sheet		0.275

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY336686.1	complete	109	523-194(-)
Amino Acid sequence :
MYGETQFTRTPCLPSSTAAFFISPTTPCFDAVYAWAPTPPSTLATVAVEMMLPRRLGIITLAACFVPRNTPARFTPTTRLNSDSGKSESSLNCGDSMMPALLYMMSRVP*
Physicochemical properties
Number of amino acids:		109
Molecular weight:		11,831.655
Theoretical pI:		8.473
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		9970 10220
Instability index:		62.649
aromaticity		0.092
GRAVY		0.114
Secondary Structure Fraction
Helix		0.248
turn		0.284
sheet		0.275

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY336686.1	internal	196	3-590(+)
Amino Acid sequence :
FGAASGIGEAAARLFSRHGAKVVIADVQDDVARSICKDLGSTFVHCDVTKESDVEAAVNAAVKTHGTLDIMYNNAGIIESPQFKLLSDFPLSEFNRVVGVNLAGVFLGTKHAARVMIPKR RGSIISTATVASVLGGVGAHAYTASKHGVVGLMKNAAVELGRHGVRVNCVSPYIVATPMTRKFLESSDEGLTDFFY
Physicochemical properties
Number of amino acids:		196
Molecular weight:		11,831.655
Theoretical pI:		8.473
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		9970 10220
Instability index:		62.649
aromaticity		0.092
GRAVY		0.114
Secondary Structure Fraction
Helix		0.248
turn		0.284
sheet		0.275

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY336686.1	5prime_partial	128	590-204(-)
Amino Acid sequence :
IKEIRQPLIAALQEFPRHRGSHDVRRDAVHADAVPPQLHGGVLHQPHHAVLRRGVRVGADAAQHAGDGRRRDDAPPPLGDHHPGGVFRPQKHAGEVHADDAVEFRQREVGEQLELRRLDD AGVVVHDV*
Physicochemical properties
Number of amino acids:		128
Molecular weight:		11,831.655
Theoretical pI:		8.473
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		9970 10220
Instability index:		62.649
aromaticity		0.092
GRAVY		0.114
Secondary Structure Fraction
Helix		0.248
turn		0.284
sheet		0.275

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY336686.1	complete	109	523-194(-)
Amino Acid sequence :
MYGETQFTRTPCLPSSTAAFFISPTTPCFDAVYAWAPTPPSTLATVAVEMMLPRRLGIITLAACFVPRNTPARFTPTTRLNSDSGKSESSLNCGDSMMPALLYMMSRVP*
Physicochemical properties
Number of amino acids:		109
Molecular weight:		11,831.655
Theoretical pI:		8.473
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		9970 10220
Instability index:		62.649
aromaticity		0.092
GRAVY		0.114
Secondary Structure Fraction
Helix		0.248
turn		0.284
sheet		0.275