Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336689.1 | complete | 217 | 126-779(+) |
Amino Acid sequence : | |||
MPEQTADKLEKKASTSVALENDKDESTDSDSESIPELEDPTSGTGGITSEALSNATGLPMDNVSKAKQTRSEKKARKIFSKLGLKQIPGVNRVTIRKSKNILFVINKPDVFKNPASDTYI VFGEAKIEDLSQQAQVAAAEKFKTQDVSGLNADVLASTKSVPPIQEESEDEEADETGLDQKDIDLVMHQTNVNRSRAIKALRKNNSDIVNAIMDLTL* | |||
Physicochemical properties | |||
Number of amino acids: | 217 | ||
Molecular weight: | 11,565.199 | ||
Theoretical pI: | 4.338 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
Instability index: | 43.649 | ||
aromaticity | 0.093 | ||
GRAVY | 0.517 | ||
Secondary Structure Fraction | |||
Helix | 0.346 | ||
turn | 0.308 | ||
sheet | 0.280 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336689.1 | complete | 107 | 439-116(-) |
Amino Acid sequence : | |||
MTNRMFLDLRMVTLLTPGICFRPNFENIFLAFFSDRVCLALLTLSIGRPVALLRASEVMPPVPDVGSSNSGMDSESESVDSSLSFSSATEVDAFFSNLSAVCSGIFV* | |||
Physicochemical properties | |||
Number of amino acids: | 107 | ||
Molecular weight: | 11,565.199 | ||
Theoretical pI: | 4.338 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
Instability index: | 43.649 | ||
aromaticity | 0.093 | ||
GRAVY | 0.517 | ||
Secondary Structure Fraction | |||
Helix | 0.346 | ||
turn | 0.308 | ||
sheet | 0.280 |