| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336689.1 | complete | 217 | 126-779(+) |
Amino Acid sequence : | |||
| MPEQTADKLEKKASTSVALENDKDESTDSDSESIPELEDPTSGTGGITSEALSNATGLPMDNVSKAKQTRSEKKARKIFSKLGLKQIPGVNRVTIRKSKNILFVINKPDVFKNPASDTYI VFGEAKIEDLSQQAQVAAAEKFKTQDVSGLNADVLASTKSVPPIQEESEDEEADETGLDQKDIDLVMHQTNVNRSRAIKALRKNNSDIVNAIMDLTL* | |||
Physicochemical properties | |||
| Number of amino acids: | 217 | ||
| Molecular weight: | 11,565.199 | ||
| Theoretical pI: | 4.338 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
| Instability index: | 43.649 | ||
| aromaticity | 0.093 | ||
| GRAVY | 0.517 | ||
Secondary Structure Fraction | |||
| Helix | 0.346 | ||
| turn | 0.308 | ||
| sheet | 0.280 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336689.1 | complete | 107 | 439-116(-) |
Amino Acid sequence : | |||
| MTNRMFLDLRMVTLLTPGICFRPNFENIFLAFFSDRVCLALLTLSIGRPVALLRASEVMPPVPDVGSSNSGMDSESESVDSSLSFSSATEVDAFFSNLSAVCSGIFV* | |||
Physicochemical properties | |||
| Number of amino acids: | 107 | ||
| Molecular weight: | 11,565.199 | ||
| Theoretical pI: | 4.338 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
| Instability index: | 43.649 | ||
| aromaticity | 0.093 | ||
| GRAVY | 0.517 | ||
Secondary Structure Fraction | |||
| Helix | 0.346 | ||
| turn | 0.308 | ||
| sheet | 0.280 | ||