Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336721.1 | 5prime_partial | 131 | 3-398(+) |
Amino Acid sequence : | |||
AEALLMGILVEGTSLAAKFLRENGVTLFKVREESVKLLGKSDMYFFSPEHPPLTEPAQRALDWAVKEKLKSGESGEITAAYICLGVWSQEESAGHKMLAALGFDDEKAAELSKNMDKDII LSYERSLQSVS* | |||
Physicochemical properties | |||
Number of amino acids: | 131 | ||
Molecular weight: | 14,409.312 | ||
Theoretical pI: | 4.967 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15470 | ||
Instability index: | 44.171 | ||
aromaticity | 0.076 | ||
GRAVY | -0.163 | ||
Secondary Structure Fraction | |||
Helix | 0.298 | ||
turn | 0.214 | ||
sheet | 0.382 |