Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336722.1 | 5prime_partial | 218 | 2-658(+) |
Amino Acid sequence : | |||
GKRREKEVNGEMTDVQRGDDVVSVELPAPASWKKLYLPKKGGTPRKSEIVFISPTGEEISNRRQLEQYLKAHEGSPPLSEFDWTTGETPRRSARISEKAKSTPPSKEIAPQTKRRKRSSI TKKEADAGKEATEGTEADKKEDVAGTEVTEGMDVDKKQEVAGTEEKVDEKKKKKKNSKPRAEFGTRVSFHIRRRLEQQWWARRKPRRLMKASTTGSLS* | |||
Physicochemical properties | |||
Number of amino acids: | 218 | ||
Molecular weight: | 24,688.569 | ||
Theoretical pI: | 9.882 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 24980 24980 | ||
Instability index: | 59.878 | ||
aromaticity | 0.046 | ||
GRAVY | -1.276 | ||
Secondary Structure Fraction | |||
Helix | 0.174 | ||
turn | 0.225 | ||
sheet | 0.243 |