| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336731.1 | internal | 272 | 1-816(+) |
Amino Acid sequence : | |||
| RIPPTPTMETAKNEAEVVIFSAIDDLMKKTGLKPKDIDILIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLQVLPNSRALVVSTEIITPNYYQGSERAML LPNCLFRMGGAAILLSNKRKDSTRAKYRLMHVVRTHKGADDKAFKCVFQQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGRKIFNPKWKAYIPDFKQAFEH FCIHAGGRAVIDELQKNLQLSAEHVEASRMTL | |||
Physicochemical properties | |||
| Number of amino acids: | 272 | ||
| Molecular weight: | 30,134.998 | ||
| Theoretical pI: | 9.383 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14690 | ||
| Instability index: | 34.243 | ||
| aromaticity | 0.066 | ||
| GRAVY | -0.014 | ||
Secondary Structure Fraction | |||
| Helix | 0.320 | ||
| turn | 0.228 | ||
| sheet | 0.276 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336731.1 | internal | 272 | 1-816(+) |
Amino Acid sequence : | |||
| RIPPTPTMETAKNEAEVVIFSAIDDLMKKTGLKPKDIDILIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLQVLPNSRALVVSTEIITPNYYQGSERAML LPNCLFRMGGAAILLSNKRKDSTRAKYRLMHVVRTHKGADDKAFKCVFQQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGRKIFNPKWKAYIPDFKQAFEH FCIHAGGRAVIDELQKNLQLSAEHVEASRMTL | |||
Physicochemical properties | |||
| Number of amino acids: | 272 | ||
| Molecular weight: | 30,134.998 | ||
| Theoretical pI: | 9.383 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14690 | ||
| Instability index: | 34.243 | ||
| aromaticity | 0.066 | ||
| GRAVY | -0.014 | ||
Secondary Structure Fraction | |||
| Helix | 0.320 | ||
| turn | 0.228 | ||
| sheet | 0.276 | ||