| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336735.1 | 5prime_partial | 200 | 2-604(+) |
Amino Acid sequence : | |||
| ESEKSVCDWPNRVSWIMDDQETPGRWLLCQRHNKTSSRAEEGHQLHHQPPRRGGATTDLQRRPRQAGDILAGDTRMQRRLPHGSPSRLCRERIGGSKAEASHRKLTRHPASLRRFQHSPP RCLHFQHLRRGLWLRHKLLRPRRLEFVDRRGSDPQPEDIRRAVHRDENVDGEGSYLSGREAGIRPGYGGSYMDSRPFHLP* | |||
Physicochemical properties | |||
| Number of amino acids: | 200 | ||
| Molecular weight: | 15,101.068 | ||
| Theoretical pI: | 8.518 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
| Instability index: | 36.388 | ||
| aromaticity | 0.072 | ||
| GRAVY | -0.146 | ||
Secondary Structure Fraction | |||
| Helix | 0.290 | ||
| turn | 0.232 | ||
| sheet | 0.268 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336735.1 | 5prime_partial | 138 | 3-419(+) |
Amino Acid sequence : | |||
| NQKKVCVTGLTGFLGSWMIKRLLEDGYSVNATIRLHPERKRDISYITNLPGAAERLQIFNADLDKPETFLPAIQGCSGVFHMAHPLDFAEKESEEVKLKRVTASLQGILQACADSNTVRR VVYTSSISAAAFGSATNS* | |||
Physicochemical properties | |||
| Number of amino acids: | 138 | ||
| Molecular weight: | 15,101.068 | ||
| Theoretical pI: | 8.518 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
| Instability index: | 36.388 | ||
| aromaticity | 0.072 | ||
| GRAVY | -0.146 | ||
Secondary Structure Fraction | |||
| Helix | 0.290 | ||
| turn | 0.232 | ||
| sheet | 0.268 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336735.1 | 5prime_partial | 200 | 2-604(+) |
Amino Acid sequence : | |||
| ESEKSVCDWPNRVSWIMDDQETPGRWLLCQRHNKTSSRAEEGHQLHHQPPRRGGATTDLQRRPRQAGDILAGDTRMQRRLPHGSPSRLCRERIGGSKAEASHRKLTRHPASLRRFQHSPP RCLHFQHLRRGLWLRHKLLRPRRLEFVDRRGSDPQPEDIRRAVHRDENVDGEGSYLSGREAGIRPGYGGSYMDSRPFHLP* | |||
Physicochemical properties | |||
| Number of amino acids: | 200 | ||
| Molecular weight: | 15,101.068 | ||
| Theoretical pI: | 8.518 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
| Instability index: | 36.388 | ||
| aromaticity | 0.072 | ||
| GRAVY | -0.146 | ||
Secondary Structure Fraction | |||
| Helix | 0.290 | ||
| turn | 0.232 | ||
| sheet | 0.268 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336735.1 | 5prime_partial | 138 | 3-419(+) |
Amino Acid sequence : | |||
| NQKKVCVTGLTGFLGSWMIKRLLEDGYSVNATIRLHPERKRDISYITNLPGAAERLQIFNADLDKPETFLPAIQGCSGVFHMAHPLDFAEKESEEVKLKRVTASLQGILQACADSNTVRR VVYTSSISAAAFGSATNS* | |||
Physicochemical properties | |||
| Number of amino acids: | 138 | ||
| Molecular weight: | 15,101.068 | ||
| Theoretical pI: | 8.518 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
| Instability index: | 36.388 | ||
| aromaticity | 0.072 | ||
| GRAVY | -0.146 | ||
Secondary Structure Fraction | |||
| Helix | 0.290 | ||
| turn | 0.232 | ||
| sheet | 0.268 | ||