| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336751.1 | 5prime_partial | 223 | 737-66(-) |
Amino Acid sequence : | |||
| ELAKWYGPDRRIFLPEGLLDRSEIPEYLNGEVPGDYGYDPFGLSKKPEDFAKYQAYELIHARWAMLGAAGFIIPEAFNKFGANCGPEAVWFKTGALLLDGNTLNYFGKNIPINLILAVVA EVVLVGGAEYYRIINGLDLEDKLHPGGPFDPLGLAKDPDQAAILKVKEIKNGRLAMFSMLGFFIQAYVTGQGPVENLAAHLSDPFGNNLLTVIGGASERVPTL* | |||
Physicochemical properties | |||
| Number of amino acids: | 223 | ||
| Molecular weight: | 24,344.648 | ||
| Theoretical pI: | 4.922 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 31400 31400 | ||
| Instability index: | 25.345 | ||
| aromaticity | 0.117 | ||
| GRAVY | 0.029 | ||
Secondary Structure Fraction | |||
| Helix | 0.359 | ||
| turn | 0.265 | ||
| sheet | 0.305 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336751.1 | 5prime_partial | 223 | 737-66(-) |
Amino Acid sequence : | |||
| ELAKWYGPDRRIFLPEGLLDRSEIPEYLNGEVPGDYGYDPFGLSKKPEDFAKYQAYELIHARWAMLGAAGFIIPEAFNKFGANCGPEAVWFKTGALLLDGNTLNYFGKNIPINLILAVVA EVVLVGGAEYYRIINGLDLEDKLHPGGPFDPLGLAKDPDQAAILKVKEIKNGRLAMFSMLGFFIQAYVTGQGPVENLAAHLSDPFGNNLLTVIGGASERVPTL* | |||
Physicochemical properties | |||
| Number of amino acids: | 223 | ||
| Molecular weight: | 24,344.648 | ||
| Theoretical pI: | 4.922 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 31400 31400 | ||
| Instability index: | 25.345 | ||
| aromaticity | 0.117 | ||
| GRAVY | 0.029 | ||
Secondary Structure Fraction | |||
| Helix | 0.359 | ||
| turn | 0.265 | ||
| sheet | 0.305 | ||