Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336752.1 | 3prime_partial | 213 | 17-655(+) |
Amino Acid sequence : | |||
MAATTSLYVSEMLGSPRKFSGVARPAAPSPSSSATCKTVALFKKKAAAAPAKAKAAAVSPADDELAKWYGPEITIFLPEGLLDRSEIPEYLNGEVPGDYGYDPFGLSKKPKDFTKYQAYE LIHTTWAMLGAAGFIIPEAFNEFGANCGPEAVWFKTGALLLNGNTLNYFGKNIPINLILAVVTEVVLVGGAEYYRMINGLDLEDNLHPCGPFD | |||
Physicochemical properties | |||
Number of amino acids: | 213 | ||
Molecular weight: | 22,860.907 | ||
Theoretical pI: | 5.138 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 31400 31525 | ||
Instability index: | 32.523 | ||
aromaticity | 0.113 | ||
GRAVY | 0.011 | ||
Secondary Structure Fraction | |||
Helix | 0.310 | ||
turn | 0.268 | ||
sheet | 0.315 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336752.1 | 3prime_partial | 213 | 17-655(+) |
Amino Acid sequence : | |||
MAATTSLYVSEMLGSPRKFSGVARPAAPSPSSSATCKTVALFKKKAAAAPAKAKAAAVSPADDELAKWYGPEITIFLPEGLLDRSEIPEYLNGEVPGDYGYDPFGLSKKPKDFTKYQAYE LIHTTWAMLGAAGFIIPEAFNEFGANCGPEAVWFKTGALLLNGNTLNYFGKNIPINLILAVVTEVVLVGGAEYYRMINGLDLEDNLHPCGPFD | |||
Physicochemical properties | |||
Number of amino acids: | 213 | ||
Molecular weight: | 22,860.907 | ||
Theoretical pI: | 5.138 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 31400 31525 | ||
Instability index: | 32.523 | ||
aromaticity | 0.113 | ||
GRAVY | 0.011 | ||
Secondary Structure Fraction | |||
Helix | 0.310 | ||
turn | 0.268 | ||
sheet | 0.315 |