| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336757.1 | internal | 191 | 3-575(+) |
Amino Acid sequence : | |||
| SSFIRRSNPHKLSPPCRRAHAALPIVGYFPFLRRDMHRQITELAAVHGPIYKLRLGGKLCTVISSASVAKELLRDYDTVFASHGVSVMAAIISLNFNDISFAPYGPKWRERRKILLRELV SNSNLNASSNLRRDQVPEMANDIYTGKIGQGGKIFDFALRMDLKLIINMIWGGKITAERRDRISDGLAPMV | |||
Physicochemical properties | |||
| Number of amino acids: | 191 | ||
| Molecular weight: | 14,975.597 | ||
| Theoretical pI: | 7.247 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 12950 | ||
| Instability index: | 66.684 | ||
| aromaticity | 0.088 | ||
| GRAVY | -0.410 | ||
Secondary Structure Fraction | |||
| Helix | 0.309 | ||
| turn | 0.294 | ||
| sheet | 0.199 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336757.1 | 5prime_partial | 155 | 2-469(+) |
Amino Acid sequence : | |||
| FFLHKTIKSTQIKPALPPGPRGTADRRLFSVSPPRYAPPDHRTGGRTRPDLQAPPRGETLHRHKLRFGGQRAAPRLRHRFCQPRRFRHGGHHLPQLQRHLLRAVRPQMARTAQDIVEGVG KQFQPQRLLQSPERSSSRNGERHLYRKDWTGWKNI* | |||
Physicochemical properties | |||
| Number of amino acids: | 155 | ||
| Molecular weight: | 14,975.597 | ||
| Theoretical pI: | 7.247 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 12950 | ||
| Instability index: | 66.684 | ||
| aromaticity | 0.088 | ||
| GRAVY | -0.410 | ||
Secondary Structure Fraction | |||
| Helix | 0.309 | ||
| turn | 0.294 | ||
| sheet | 0.199 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336757.1 | 5prime_partial | 136 | 575-165(-) |
Amino Acid sequence : | |||
| HHRRQPIRNPISPLRRNLAAPNHIYDKLQIHSQSKIKYFSTLSNLSGIDVVRHFWNLISPEIGGGVEVGIAYQLPQQYLAPFAPFGAVRREGDVVEVEGDDGRHDGNAVAGKNGVVVAEQ LFGHRSGAYDGAEFPP* | |||
Physicochemical properties | |||
| Number of amino acids: | 136 | ||
| Molecular weight: | 14,975.597 | ||
| Theoretical pI: | 7.247 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 12950 | ||
| Instability index: | 66.684 | ||
| aromaticity | 0.088 | ||
| GRAVY | -0.410 | ||
Secondary Structure Fraction | |||
| Helix | 0.309 | ||
| turn | 0.294 | ||
| sheet | 0.199 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336757.1 | internal | 191 | 3-575(+) |
Amino Acid sequence : | |||
| SSFIRRSNPHKLSPPCRRAHAALPIVGYFPFLRRDMHRQITELAAVHGPIYKLRLGGKLCTVISSASVAKELLRDYDTVFASHGVSVMAAIISLNFNDISFAPYGPKWRERRKILLRELV SNSNLNASSNLRRDQVPEMANDIYTGKIGQGGKIFDFALRMDLKLIINMIWGGKITAERRDRISDGLAPMV | |||
Physicochemical properties | |||
| Number of amino acids: | 191 | ||
| Molecular weight: | 14,975.597 | ||
| Theoretical pI: | 7.247 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 12950 | ||
| Instability index: | 66.684 | ||
| aromaticity | 0.088 | ||
| GRAVY | -0.410 | ||
Secondary Structure Fraction | |||
| Helix | 0.309 | ||
| turn | 0.294 | ||
| sheet | 0.199 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336757.1 | 5prime_partial | 155 | 2-469(+) |
Amino Acid sequence : | |||
| FFLHKTIKSTQIKPALPPGPRGTADRRLFSVSPPRYAPPDHRTGGRTRPDLQAPPRGETLHRHKLRFGGQRAAPRLRHRFCQPRRFRHGGHHLPQLQRHLLRAVRPQMARTAQDIVEGVG KQFQPQRLLQSPERSSSRNGERHLYRKDWTGWKNI* | |||
Physicochemical properties | |||
| Number of amino acids: | 155 | ||
| Molecular weight: | 14,975.597 | ||
| Theoretical pI: | 7.247 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 12950 | ||
| Instability index: | 66.684 | ||
| aromaticity | 0.088 | ||
| GRAVY | -0.410 | ||
Secondary Structure Fraction | |||
| Helix | 0.309 | ||
| turn | 0.294 | ||
| sheet | 0.199 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336757.1 | 5prime_partial | 136 | 575-165(-) |
Amino Acid sequence : | |||
| HHRRQPIRNPISPLRRNLAAPNHIYDKLQIHSQSKIKYFSTLSNLSGIDVVRHFWNLISPEIGGGVEVGIAYQLPQQYLAPFAPFGAVRREGDVVEVEGDDGRHDGNAVAGKNGVVVAEQ LFGHRSGAYDGAEFPP* | |||
Physicochemical properties | |||
| Number of amino acids: | 136 | ||
| Molecular weight: | 14,975.597 | ||
| Theoretical pI: | 7.247 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 12950 | ||
| Instability index: | 66.684 | ||
| aromaticity | 0.088 | ||
| GRAVY | -0.410 | ||
Secondary Structure Fraction | |||
| Helix | 0.309 | ||
| turn | 0.294 | ||
| sheet | 0.199 | ||