Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336757.1 | internal | 191 | 3-575(+) |
Amino Acid sequence : | |||
SSFIRRSNPHKLSPPCRRAHAALPIVGYFPFLRRDMHRQITELAAVHGPIYKLRLGGKLCTVISSASVAKELLRDYDTVFASHGVSVMAAIISLNFNDISFAPYGPKWRERRKILLRELV SNSNLNASSNLRRDQVPEMANDIYTGKIGQGGKIFDFALRMDLKLIINMIWGGKITAERRDRISDGLAPMV | |||
Physicochemical properties | |||
Number of amino acids: | 191 | ||
Molecular weight: | 14,975.597 | ||
Theoretical pI: | 7.247 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 12950 | ||
Instability index: | 66.684 | ||
aromaticity | 0.088 | ||
GRAVY | -0.410 | ||
Secondary Structure Fraction | |||
Helix | 0.309 | ||
turn | 0.294 | ||
sheet | 0.199 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336757.1 | 5prime_partial | 155 | 2-469(+) |
Amino Acid sequence : | |||
FFLHKTIKSTQIKPALPPGPRGTADRRLFSVSPPRYAPPDHRTGGRTRPDLQAPPRGETLHRHKLRFGGQRAAPRLRHRFCQPRRFRHGGHHLPQLQRHLLRAVRPQMARTAQDIVEGVG KQFQPQRLLQSPERSSSRNGERHLYRKDWTGWKNI* | |||
Physicochemical properties | |||
Number of amino acids: | 155 | ||
Molecular weight: | 14,975.597 | ||
Theoretical pI: | 7.247 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 12950 | ||
Instability index: | 66.684 | ||
aromaticity | 0.088 | ||
GRAVY | -0.410 | ||
Secondary Structure Fraction | |||
Helix | 0.309 | ||
turn | 0.294 | ||
sheet | 0.199 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336757.1 | 5prime_partial | 136 | 575-165(-) |
Amino Acid sequence : | |||
HHRRQPIRNPISPLRRNLAAPNHIYDKLQIHSQSKIKYFSTLSNLSGIDVVRHFWNLISPEIGGGVEVGIAYQLPQQYLAPFAPFGAVRREGDVVEVEGDDGRHDGNAVAGKNGVVVAEQ LFGHRSGAYDGAEFPP* | |||
Physicochemical properties | |||
Number of amino acids: | 136 | ||
Molecular weight: | 14,975.597 | ||
Theoretical pI: | 7.247 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 12950 | ||
Instability index: | 66.684 | ||
aromaticity | 0.088 | ||
GRAVY | -0.410 | ||
Secondary Structure Fraction | |||
Helix | 0.309 | ||
turn | 0.294 | ||
sheet | 0.199 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336757.1 | internal | 191 | 3-575(+) |
Amino Acid sequence : | |||
SSFIRRSNPHKLSPPCRRAHAALPIVGYFPFLRRDMHRQITELAAVHGPIYKLRLGGKLCTVISSASVAKELLRDYDTVFASHGVSVMAAIISLNFNDISFAPYGPKWRERRKILLRELV SNSNLNASSNLRRDQVPEMANDIYTGKIGQGGKIFDFALRMDLKLIINMIWGGKITAERRDRISDGLAPMV | |||
Physicochemical properties | |||
Number of amino acids: | 191 | ||
Molecular weight: | 14,975.597 | ||
Theoretical pI: | 7.247 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 12950 | ||
Instability index: | 66.684 | ||
aromaticity | 0.088 | ||
GRAVY | -0.410 | ||
Secondary Structure Fraction | |||
Helix | 0.309 | ||
turn | 0.294 | ||
sheet | 0.199 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336757.1 | 5prime_partial | 155 | 2-469(+) |
Amino Acid sequence : | |||
FFLHKTIKSTQIKPALPPGPRGTADRRLFSVSPPRYAPPDHRTGGRTRPDLQAPPRGETLHRHKLRFGGQRAAPRLRHRFCQPRRFRHGGHHLPQLQRHLLRAVRPQMARTAQDIVEGVG KQFQPQRLLQSPERSSSRNGERHLYRKDWTGWKNI* | |||
Physicochemical properties | |||
Number of amino acids: | 155 | ||
Molecular weight: | 14,975.597 | ||
Theoretical pI: | 7.247 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 12950 | ||
Instability index: | 66.684 | ||
aromaticity | 0.088 | ||
GRAVY | -0.410 | ||
Secondary Structure Fraction | |||
Helix | 0.309 | ||
turn | 0.294 | ||
sheet | 0.199 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336757.1 | 5prime_partial | 136 | 575-165(-) |
Amino Acid sequence : | |||
HHRRQPIRNPISPLRRNLAAPNHIYDKLQIHSQSKIKYFSTLSNLSGIDVVRHFWNLISPEIGGGVEVGIAYQLPQQYLAPFAPFGAVRREGDVVEVEGDDGRHDGNAVAGKNGVVVAEQ LFGHRSGAYDGAEFPP* | |||
Physicochemical properties | |||
Number of amino acids: | 136 | ||
Molecular weight: | 14,975.597 | ||
Theoretical pI: | 7.247 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 12950 | ||
Instability index: | 66.684 | ||
aromaticity | 0.088 | ||
GRAVY | -0.410 | ||
Secondary Structure Fraction | |||
Helix | 0.309 | ||
turn | 0.294 | ||
sheet | 0.199 |