| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336760.1 | internal | 234 | 3-704(+) |
Amino Acid sequence : | |||
| HRLLGSAVVLPEFTATQNTLPYALSLAFTYHTNPPPERLLKAIPHALPFHVYLRTGNGFDDISQNFGQPDVVVNCAALSVPRACEVDSTAAMAINVPSALVKWLSSFSNGGTLLIHLSTD QVYEGTKSFYKEDDETLPVNVYGRSKVEAEQFISANYSNYAILRSRIIYGPQTVSPVPKSLPVQWMDSVLAKGEAMDFFHDEFRCPVYVKDLVTIIWTLTNKWISEKEPMQLVL | |||
Physicochemical properties | |||
| Number of amino acids: | 234 | ||
| Molecular weight: | 26,110.546 | ||
| Theoretical pI: | 5.662 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 36900 37025 | ||
| Instability index: | 39.139 | ||
| aromaticity | 0.107 | ||
| GRAVY | -0.014 | ||
Secondary Structure Fraction | |||
| Helix | 0.350 | ||
| turn | 0.244 | ||
| sheet | 0.248 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336760.1 | internal | 234 | 3-704(+) |
Amino Acid sequence : | |||
| HRLLGSAVVLPEFTATQNTLPYALSLAFTYHTNPPPERLLKAIPHALPFHVYLRTGNGFDDISQNFGQPDVVVNCAALSVPRACEVDSTAAMAINVPSALVKWLSSFSNGGTLLIHLSTD QVYEGTKSFYKEDDETLPVNVYGRSKVEAEQFISANYSNYAILRSRIIYGPQTVSPVPKSLPVQWMDSVLAKGEAMDFFHDEFRCPVYVKDLVTIIWTLTNKWISEKEPMQLVL | |||
Physicochemical properties | |||
| Number of amino acids: | 234 | ||
| Molecular weight: | 26,110.546 | ||
| Theoretical pI: | 5.662 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 36900 37025 | ||
| Instability index: | 39.139 | ||
| aromaticity | 0.107 | ||
| GRAVY | -0.014 | ||
Secondary Structure Fraction | |||
| Helix | 0.350 | ||
| turn | 0.244 | ||
| sheet | 0.248 | ||