Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336765.1 | complete | 149 | 122-571(+) |
Amino Acid sequence : | |||
MGSKNAKPITKTEQCESFFNFFSPPQVPDEEDDIDEDAAEELQNLMEQNYDIGSTIRDKIIPHAVSWFTGEAAQDEYGEADDDEQDIDEDNEEEDEDKDEEDEDDEDEDEDDEKESTSRK KPSAGRKRRGREPPVDGQQGERPPQCKQQ* | |||
Physicochemical properties | |||
Number of amino acids: | 149 | ||
Molecular weight: | 12,049.579 | ||
Theoretical pI: | 11.899 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
Instability index: | 41.997 | ||
aromaticity | 0.029 | ||
GRAVY | -0.927 | ||
Secondary Structure Fraction | |||
Helix | 0.147 | ||
turn | 0.216 | ||
sheet | 0.333 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336765.1 | complete | 106 | 627-307(-) |
Amino Acid sequence : | |||
MRGAFPHENRTPEVATINSYCCLHCGGLSPCCPSTGGSLPLLLRPADGFFLLVLSFSSSSSSSSSSSSSSSLSSSSSSLSSSISCSSSSASPYSSCAASPVNHDTA* | |||
Physicochemical properties | |||
Number of amino acids: | 106 | ||
Molecular weight: | 12,049.579 | ||
Theoretical pI: | 11.899 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
Instability index: | 41.997 | ||
aromaticity | 0.029 | ||
GRAVY | -0.927 | ||
Secondary Structure Fraction | |||
Helix | 0.147 | ||
turn | 0.216 | ||
sheet | 0.333 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336765.1 | complete | 102 | 270-578(+) |
Amino Acid sequence : | |||
MILGRPSETKLFLMRYHGSLERLHRMSMGKPMMMNKILMKTMKKRMRTRMKKMKTTRTRMRMMKKKARAEKSRQQGARGGEENLLWMGNKVRGLHSASNSSC* | |||
Physicochemical properties | |||
Number of amino acids: | 102 | ||
Molecular weight: | 12,049.579 | ||
Theoretical pI: | 11.899 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
Instability index: | 41.997 | ||
aromaticity | 0.029 | ||
GRAVY | -0.927 | ||
Secondary Structure Fraction | |||
Helix | 0.147 | ||
turn | 0.216 | ||
sheet | 0.333 |