| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336767.1 | 5prime_partial | 127 | 2-385(+) |
Amino Acid sequence : | |||
| APVNEMGLLTQKNVDVVDTTCPWVSKVWHAVENHENGDYTSIIHGKYAHKKTVSTASFAGNYILEQNITEATYVCDYILCGGLDGSSSTKEAFLKKFKPAVSKGFDPDKHLQKVGIANQT TMLKGET* | |||
Physicochemical properties | |||
| Number of amino acids: | 127 | ||
| Molecular weight: | 13,922.586 | ||
| Theoretical pI: | 6.567 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18575 | ||
| Instability index: | 21.850 | ||
| aromaticity | 0.087 | ||
| GRAVY | -0.357 | ||
Secondary Structure Fraction | |||
| Helix | 0.283 | ||
| turn | 0.228 | ||
| sheet | 0.205 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336767.1 | 5prime_partial | 127 | 2-385(+) |
Amino Acid sequence : | |||
| APVNEMGLLTQKNVDVVDTTCPWVSKVWHAVENHENGDYTSIIHGKYAHKKTVSTASFAGNYILEQNITEATYVCDYILCGGLDGSSSTKEAFLKKFKPAVSKGFDPDKHLQKVGIANQT TMLKGET* | |||
Physicochemical properties | |||
| Number of amino acids: | 127 | ||
| Molecular weight: | 13,922.586 | ||
| Theoretical pI: | 6.567 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18575 | ||
| Instability index: | 21.850 | ||
| aromaticity | 0.087 | ||
| GRAVY | -0.357 | ||
Secondary Structure Fraction | |||
| Helix | 0.283 | ||
| turn | 0.228 | ||
| sheet | 0.205 | ||