| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336775.1 | complete | 112 | 75-413(+) |
Amino Acid sequence : | |||
| MPCLDISTNVNLDEFDADSLFSTLTTAVSQIVGKPENFVMIVVKGSVALTFGGSKEPAAFAEIMAMGGLNTKVKRELIATIGSILQDKLSIPRTRFILKVFDANMARNLSKL* | |||
Physicochemical properties | |||
| Number of amino acids: | 112 | ||
| Molecular weight: | 12,094.059 | ||
| Theoretical pI: | 7.858 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 30.169 | ||
| aromaticity | 0.063 | ||
| GRAVY | 0.320 | ||
Secondary Structure Fraction | |||
| Helix | 0.330 | ||
| turn | 0.232 | ||
| sheet | 0.286 | ||