Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336791.1 | internal | 266 | 2-799(+) |
Amino Acid sequence : | |||
AKPVKNLSCSSLEVDEMADTFLFTSESVNEGHPDKLCDQISDAVLDACLEQDPDSKVACETCTKTNMVMVFGEIITKANIDYEKIVRDTCRSIGFVSDDVGLDADKCKVLVNIEQQSPDI AQGVHGHLTKRPEDIGAGDQGHMFGYATDETPEYMPLSHVLATKLGARLTEVRKDGTCPWLRPDGKTQVTVEYYNENGAMVPIRVHTVLISTQHDETVTNDEIARDLKEHVIKPVIPEKY LDEKTIFHLNPSGRFVIGGPHGDAGL | |||
Physicochemical properties | |||
Number of amino acids: | 266 | ||
Molecular weight: | 10,660.792 | ||
Theoretical pI: | 4.050 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
Instability index: | 20.259 | ||
aromaticity | 0.010 | ||
GRAVY | 0.008 | ||
Secondary Structure Fraction | |||
Helix | 0.356 | ||
turn | 0.208 | ||
sheet | 0.248 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336791.1 | complete | 117 | 382-29(-) |
Amino Acid sequence : | |||
MTVNALSDIRALLLDVDQNLALVSIETNVVRDKPNRAARVADDLLVVYVGLGYDLSKDHHHVGLGASLTSHLAIGILLEASIENRVGDLIAELVGVPLVHALRGKQEGVRHFVDLKR* | |||
Physicochemical properties | |||
Number of amino acids: | 117 | ||
Molecular weight: | 10,660.792 | ||
Theoretical pI: | 4.050 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
Instability index: | 20.259 | ||
aromaticity | 0.010 | ||
GRAVY | 0.008 | ||
Secondary Structure Fraction | |||
Helix | 0.356 | ||
turn | 0.208 | ||
sheet | 0.248 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336791.1 | 5prime_partial | 101 | 799-494(-) |
Amino Acid sequence : | |||
ETRIAVGPTDDETPGGVKVEDGLLVQVLLGDDWLDDVLLEIPRDLVVGDGLVVLGRDEDGVDPDGDHRTVLVVVLDGDLGLPVGSQPRARTVLADLRQTSA* | |||
Physicochemical properties | |||
Number of amino acids: | 101 | ||
Molecular weight: | 10,660.792 | ||
Theoretical pI: | 4.050 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
Instability index: | 20.259 | ||
aromaticity | 0.010 | ||
GRAVY | 0.008 | ||
Secondary Structure Fraction | |||
Helix | 0.356 | ||
turn | 0.208 | ||
sheet | 0.248 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336791.1 | internal | 266 | 2-799(+) |
Amino Acid sequence : | |||
AKPVKNLSCSSLEVDEMADTFLFTSESVNEGHPDKLCDQISDAVLDACLEQDPDSKVACETCTKTNMVMVFGEIITKANIDYEKIVRDTCRSIGFVSDDVGLDADKCKVLVNIEQQSPDI AQGVHGHLTKRPEDIGAGDQGHMFGYATDETPEYMPLSHVLATKLGARLTEVRKDGTCPWLRPDGKTQVTVEYYNENGAMVPIRVHTVLISTQHDETVTNDEIARDLKEHVIKPVIPEKY LDEKTIFHLNPSGRFVIGGPHGDAGL | |||
Physicochemical properties | |||
Number of amino acids: | 266 | ||
Molecular weight: | 10,660.792 | ||
Theoretical pI: | 4.050 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
Instability index: | 20.259 | ||
aromaticity | 0.010 | ||
GRAVY | 0.008 | ||
Secondary Structure Fraction | |||
Helix | 0.356 | ||
turn | 0.208 | ||
sheet | 0.248 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336791.1 | complete | 117 | 382-29(-) |
Amino Acid sequence : | |||
MTVNALSDIRALLLDVDQNLALVSIETNVVRDKPNRAARVADDLLVVYVGLGYDLSKDHHHVGLGASLTSHLAIGILLEASIENRVGDLIAELVGVPLVHALRGKQEGVRHFVDLKR* | |||
Physicochemical properties | |||
Number of amino acids: | 117 | ||
Molecular weight: | 10,660.792 | ||
Theoretical pI: | 4.050 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
Instability index: | 20.259 | ||
aromaticity | 0.010 | ||
GRAVY | 0.008 | ||
Secondary Structure Fraction | |||
Helix | 0.356 | ||
turn | 0.208 | ||
sheet | 0.248 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336791.1 | 5prime_partial | 101 | 799-494(-) |
Amino Acid sequence : | |||
ETRIAVGPTDDETPGGVKVEDGLLVQVLLGDDWLDDVLLEIPRDLVVGDGLVVLGRDEDGVDPDGDHRTVLVVVLDGDLGLPVGSQPRARTVLADLRQTSA* | |||
Physicochemical properties | |||
Number of amino acids: | 101 | ||
Molecular weight: | 10,660.792 | ||
Theoretical pI: | 4.050 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
Instability index: | 20.259 | ||
aromaticity | 0.010 | ||
GRAVY | 0.008 | ||
Secondary Structure Fraction | |||
Helix | 0.356 | ||
turn | 0.208 | ||
sheet | 0.248 |