| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336836.1 | internal | 185 | 1-555(+) |
Amino Acid sequence : | |||
| DISAVVDQRFLKKYHVKLNNAILAEDKHLPMYDEMTSKFKVDYIAGGATQNSIRVAQGMLQIPGATRYMGSIGKDKYGEEMKKNAKEAGVNVHYYEDDSPTGTCAVCVLGGERSLIANLS AANCYKPDHLKKPQNWALVEKAKYYYMAGFFLTGSPESMWLVAEHAIANNKVFATKLSAPFICEF | |||
Physicochemical properties | |||
| Number of amino acids: | 185 | ||
| Molecular weight: | 20,573.403 | ||
| Theoretical pI: | 8.275 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27390 27640 | ||
| Instability index: | 31.406 | ||
| aromaticity | 0.108 | ||
| GRAVY | -0.276 | ||
Secondary Structure Fraction | |||
| Helix | 0.292 | ||
| turn | 0.216 | ||
| sheet | 0.281 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336836.1 | internal | 185 | 1-555(+) |
Amino Acid sequence : | |||
| DISAVVDQRFLKKYHVKLNNAILAEDKHLPMYDEMTSKFKVDYIAGGATQNSIRVAQGMLQIPGATRYMGSIGKDKYGEEMKKNAKEAGVNVHYYEDDSPTGTCAVCVLGGERSLIANLS AANCYKPDHLKKPQNWALVEKAKYYYMAGFFLTGSPESMWLVAEHAIANNKVFATKLSAPFICEF | |||
Physicochemical properties | |||
| Number of amino acids: | 185 | ||
| Molecular weight: | 20,573.403 | ||
| Theoretical pI: | 8.275 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27390 27640 | ||
| Instability index: | 31.406 | ||
| aromaticity | 0.108 | ||
| GRAVY | -0.276 | ||
Secondary Structure Fraction | |||
| Helix | 0.292 | ||
| turn | 0.216 | ||
| sheet | 0.281 | ||