Acc_NO	ORF type	length	start-end position (strand +/-)
>DY336851.1	complete	162	92-580(+)
Amino Acid sequence :
MGSDADMEDYGFEYSDEEQEEQDVDIENQYYNSKGMVETDPKGALEGFAEVVHMEPEKAEWGFKALKQTVKLYYKLGKFKEMMDSYREMLTYIKSAVTRNYSEKCINGIMDFVSGSASQN FSLLQEFYQTTLKALEEAKNERLWFKTNLKLCKIWFDMGEYG*
Physicochemical properties
Number of amino acids:		162
Molecular weight:		18,955.100
Theoretical pI:		4.596
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		32890 33015
Instability index:		21.409
aromaticity		0.142
GRAVY		-0.698
Secondary Structure Fraction
Helix		0.290
turn		0.185
sheet		0.315