| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336854.1 | internal | 256 | 2-769(+) |
Amino Acid sequence : | |||
| ALFLTSNPALLAQPLSLQVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLISCRTEFGPSQPFKGARITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAV FAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYEKSGKLPDPSSTDNAEFQIVLTLIRDGLKANPTKYRKMKERLVGVSEETTTGVKRLYQMQANGTLLFPA INVNDSVTKKQFDNLY | |||
Physicochemical properties | |||
| Number of amino acids: | 256 | ||
| Molecular weight: | 25,497.461 | ||
| Theoretical pI: | 4.719 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 43.455 | ||
| aromaticity | 0.020 | ||
| GRAVY | 0.063 | ||
Secondary Structure Fraction | |||
| Helix | 0.317 | ||
| turn | 0.289 | ||
| sheet | 0.329 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336854.1 | 5prime_partial | 246 | 769-29(-) |
Amino Acid sequence : | |||
| VQVIELLLGDGIIDIDGREKQSPISLHLIQPLHTSSCFLRNTNQSLLHLPVLGGIGLQPISDQRQHYLKLRIIGRAGVRQLPTFLVLLLRLDALVNQQRGITAVVHDEIGAAARPPIEGP LGAPPVLLQGFALPGEDGGAVASNGSGGVVLSGEDVARAPSDLSAESGEGLDEDGSLDGHVETSGDAGTLEGLGGTELGPAGNEARHLHLGELDFEAAEVGLGHVLDLVLAARGGLLNLE RQGLSE* | |||
Physicochemical properties | |||
| Number of amino acids: | 246 | ||
| Molecular weight: | 25,497.461 | ||
| Theoretical pI: | 4.719 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 43.455 | ||
| aromaticity | 0.020 | ||
| GRAVY | 0.063 | ||
Secondary Structure Fraction | |||
| Helix | 0.317 | ||
| turn | 0.289 | ||
| sheet | 0.329 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336854.1 | internal | 256 | 2-769(+) |
Amino Acid sequence : | |||
| ALFLTSNPALLAQPLSLQVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLISCRTEFGPSQPFKGARITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAV FAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYEKSGKLPDPSSTDNAEFQIVLTLIRDGLKANPTKYRKMKERLVGVSEETTTGVKRLYQMQANGTLLFPA INVNDSVTKKQFDNLY | |||
Physicochemical properties | |||
| Number of amino acids: | 256 | ||
| Molecular weight: | 25,497.461 | ||
| Theoretical pI: | 4.719 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 43.455 | ||
| aromaticity | 0.020 | ||
| GRAVY | 0.063 | ||
Secondary Structure Fraction | |||
| Helix | 0.317 | ||
| turn | 0.289 | ||
| sheet | 0.329 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336854.1 | 5prime_partial | 246 | 769-29(-) |
Amino Acid sequence : | |||
| VQVIELLLGDGIIDIDGREKQSPISLHLIQPLHTSSCFLRNTNQSLLHLPVLGGIGLQPISDQRQHYLKLRIIGRAGVRQLPTFLVLLLRLDALVNQQRGITAVVHDEIGAAARPPIEGP LGAPPVLLQGFALPGEDGGAVASNGSGGVVLSGEDVARAPSDLSAESGEGLDEDGSLDGHVETSGDAGTLEGLGGTELGPAGNEARHLHLGELDFEAAEVGLGHVLDLVLAARGGLLNLE RQGLSE* | |||
Physicochemical properties | |||
| Number of amino acids: | 246 | ||
| Molecular weight: | 25,497.461 | ||
| Theoretical pI: | 4.719 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 43.455 | ||
| aromaticity | 0.020 | ||
| GRAVY | 0.063 | ||
Secondary Structure Fraction | |||
| Helix | 0.317 | ||
| turn | 0.289 | ||
| sheet | 0.329 | ||