Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336858.1 | 5prime_partial | 237 | 3-716(+) |
Amino Acid sequence : | |||
DKADKEVLGHAAKVVLTKDSTTIVGDGSTQDAVNKRVAQIRNLIEAADQDYEKDKLNERIAKLSGGVAVIQVGAQTETELKEKKLRVEDALNATKAAVEEGIVVGGGCTLLRLASKVDAI KATLENDEEKVGADIVKRALSYPLKLIAKNAGVNGSVVSEKVLSSENPKYGYNAATGQYEDLMAAGIIDPTKVVRCCLEHASSVAKTFLMSDCVVVEIPEPEPVVAGNPMDNSGYGY* | |||
Physicochemical properties | |||
Number of amino acids: | 237 | ||
Molecular weight: | 25,131.280 | ||
Theoretical pI: | 5.077 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 10430 10680 | ||
Instability index: | 24.086 | ||
aromaticity | 0.034 | ||
GRAVY | -0.182 | ||
Secondary Structure Fraction | |||
Helix | 0.283 | ||
turn | 0.211 | ||
sheet | 0.295 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336858.1 | 5prime_partial | 237 | 3-716(+) |
Amino Acid sequence : | |||
DKADKEVLGHAAKVVLTKDSTTIVGDGSTQDAVNKRVAQIRNLIEAADQDYEKDKLNERIAKLSGGVAVIQVGAQTETELKEKKLRVEDALNATKAAVEEGIVVGGGCTLLRLASKVDAI KATLENDEEKVGADIVKRALSYPLKLIAKNAGVNGSVVSEKVLSSENPKYGYNAATGQYEDLMAAGIIDPTKVVRCCLEHASSVAKTFLMSDCVVVEIPEPEPVVAGNPMDNSGYGY* | |||
Physicochemical properties | |||
Number of amino acids: | 237 | ||
Molecular weight: | 25,131.280 | ||
Theoretical pI: | 5.077 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 10430 10680 | ||
Instability index: | 24.086 | ||
aromaticity | 0.034 | ||
GRAVY | -0.182 | ||
Secondary Structure Fraction | |||
Helix | 0.283 | ||
turn | 0.211 | ||
sheet | 0.295 |