| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336870.1 | 5prime_partial | 235 | 794-87(-) |
Amino Acid sequence : | |||
| ESEEVKLKRVTAGLQGILQACADSNTVRRVVYTSSISAAAFGSATNSDGLVDENSWTDVDLIRRLKTFGGPYIVTKTLTEKAAIDLGEKLGLDLVTVVPTWTHGPFICPNFPDSVYVAMA LILGDASHYQHLKDSSLVHVDDVARAHIHLLEYPEAKGRYIVKGPEFKIEELCDFLSARYPQYKMPSPDSWKDVVGVKFSGLSTKKLEETGFKYENGLEEMFDDAIKSCKEKGFL* | |||
Physicochemical properties | |||
| Number of amino acids: | 235 | ||
| Molecular weight: | 12,634.009 | ||
| Theoretical pI: | 11.516 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 5960 | ||
| Instability index: | 85.294 | ||
| aromaticity | 0.074 | ||
| GRAVY | -1.288 | ||
Secondary Structure Fraction | |||
| Helix | 0.213 | ||
| turn | 0.250 | ||
| sheet | 0.194 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336870.1 | 5prime_partial | 108 | 792-466(-) |
Amino Acid sequence : | |||
| IGGSKAEASHRRLTRHPAGLRRFEYCPPRGVHFQHLRRRLRLRHKLRRARRREFVDRRGSDPQAEDIRRAVHRDENVDGEGSYRSGREAGVRPGYGGSYVDSRPFHLP* | |||
Physicochemical properties | |||
| Number of amino acids: | 108 | ||
| Molecular weight: | 12,634.009 | ||
| Theoretical pI: | 11.516 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 5960 | ||
| Instability index: | 85.294 | ||
| aromaticity | 0.074 | ||
| GRAVY | -1.288 | ||
Secondary Structure Fraction | |||
| Helix | 0.213 | ||
| turn | 0.250 | ||
| sheet | 0.194 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336870.1 | 5prime_partial | 235 | 794-87(-) |
Amino Acid sequence : | |||
| ESEEVKLKRVTAGLQGILQACADSNTVRRVVYTSSISAAAFGSATNSDGLVDENSWTDVDLIRRLKTFGGPYIVTKTLTEKAAIDLGEKLGLDLVTVVPTWTHGPFICPNFPDSVYVAMA LILGDASHYQHLKDSSLVHVDDVARAHIHLLEYPEAKGRYIVKGPEFKIEELCDFLSARYPQYKMPSPDSWKDVVGVKFSGLSTKKLEETGFKYENGLEEMFDDAIKSCKEKGFL* | |||
Physicochemical properties | |||
| Number of amino acids: | 235 | ||
| Molecular weight: | 12,634.009 | ||
| Theoretical pI: | 11.516 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 5960 | ||
| Instability index: | 85.294 | ||
| aromaticity | 0.074 | ||
| GRAVY | -1.288 | ||
Secondary Structure Fraction | |||
| Helix | 0.213 | ||
| turn | 0.250 | ||
| sheet | 0.194 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336870.1 | 5prime_partial | 108 | 792-466(-) |
Amino Acid sequence : | |||
| IGGSKAEASHRRLTRHPAGLRRFEYCPPRGVHFQHLRRRLRLRHKLRRARRREFVDRRGSDPQAEDIRRAVHRDENVDGEGSYRSGREAGVRPGYGGSYVDSRPFHLP* | |||
Physicochemical properties | |||
| Number of amino acids: | 108 | ||
| Molecular weight: | 12,634.009 | ||
| Theoretical pI: | 11.516 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 5960 | ||
| Instability index: | 85.294 | ||
| aromaticity | 0.074 | ||
| GRAVY | -1.288 | ||
Secondary Structure Fraction | |||
| Helix | 0.213 | ||
| turn | 0.250 | ||
| sheet | 0.194 | ||